Citrus Sinensis ID: 046553

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
LNIDKTERCRGENRSTVDDDEQCLKWLDSWEPWSVIYACLGSICGLATWQLLELGLGLEASSQPFIWVIRGGERSQGLEKWIQEEGLEERAKGRGFIIRGWAPQVLLLSHRAIGGFLTHCGWNSTLEGVSAGVPLVTRPLFAEQFYNDKLAVQAAVTWGLEDKSGLVIKREKVKEAIEKLMDRGKQGEKRRKRTRQLGEIANRATGVGASSHRNMEMLIEFVIQRTRGQQFI
cccccHHHccccccccccccHHHHccccccccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEcccccccccccccccHHHHHHccccEEEcccccHHHHHccccccEEcccccccHHHHHHHccccccccccccccccccEEEEEEcEEEEEEccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccc
*********************QCLKWLDSWEPWSVIYACLGSICGLATWQLLELGLGLEASSQPFIWVIRGGERSQGLEKWIQEEGLEERAKGRGFIIRGWAPQVLLLSHRAIGGFLTHCGWNSTLEGVSAGVPLVTRPLFAEQFYNDKLAVQAAVTWGLEDKSGLVIKREKVKEAIEKLMDRGK***KRRKRTRQLGEIANRATGVGASSHRNMEMLIEFVIQRT******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LNIDKTERCRGENRSTVDDDEQCLKWLDSWEPWSVIYACLGSICGLATWQLLELGLGLEASSQPFIWVIRGGERSQGLEKWIQEEGLEERAKGRGFIIRGWAPQVLLLSHRAIGGFLTHCGWNSTLEGVSAGVPLVTRPLFAEQFYNDKLAVQAAVTWGLEDKSGLVIKREKVKEAIEKLMDRGKQGEKRRKRTRQLGEIANRATGVGASSHRNMEMLIEFVIQRTRGQQFI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Anthocyanidin 3-O-glucosyltransferase 4 (Fragment) In the presence of other necessary color factors, this glycosylation reaction allows the accumulation of anthocyanin pigments.probableQ40286

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PQ6, chain A
Confidence level:very confident
Coverage over the Query: 21-223
View the alignment between query and template
View the model in PyMOL