Query         046561
Match_columns 204
No_of_seqs    81 out of 83
Neff          2.4 
Searched_HMMs 46136
Date          Fri Mar 29 13:21:11 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/046561.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/046561hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04852 DUF640:  Protein of un 100.0 6.5E-76 1.4E-80  471.8  11.8  122   45-166    11-132 (132)
  2 PF08821 CGGC:  CGGC domain;  I  91.7    0.33 7.2E-06   37.8   4.5   67   63-139    29-98  (107)
  3 PF02899 Phage_int_SAM_1:  Phag  90.1    0.54 1.2E-05   31.8   3.9   40   56-96     21-60  (84)
  4 cd00798 INT_XerDC XerD and Xer  87.7     2.4 5.1E-05   32.9   6.4   69   56-151    21-91  (284)
  5 cd00799 INT_Cre Cre recombinas  86.0     7.4 0.00016   31.5   8.6   77   56-164     6-82  (287)
  6 TIGR02225 recomb_XerD tyrosine  83.8     4.5 9.7E-05   31.7   6.3   70   55-152    19-90  (291)
  7 PRK00283 xerD site-specific ty  83.2     3.6 7.9E-05   32.8   5.7   68   57-152    30-99  (299)
  8 COG1080 PtsA Phosphoenolpyruva  79.8     2.4 5.2E-05   42.0   4.2   42  122-163   305-368 (574)
  9 TIGR02224 recomb_XerC tyrosine  74.0      13 0.00028   29.3   6.1   69   58-152    22-92  (295)
 10 PF10865 DUF2703:  Domain of un  63.3     2.2 4.8E-05   34.2  -0.2   43   85-147     2-44  (120)
 11 TIGR01418 PEP_synth phosphoeno  62.6      12 0.00026   37.6   4.7   42  129-170   547-618 (782)
 12 PF00539 Tat:  Transactivating   61.5       3 6.6E-05   31.2   0.3   19  168-186    45-63  (68)
 13 PF02896 PEP-utilizers_C:  PEP-  60.0      14  0.0003   33.3   4.2   46  125-170    58-126 (293)
 14 cd01185 INT_Tn4399 Tn4399 and   59.9      38 0.00083   27.5   6.4   34   59-92     43-78  (299)
 15 PRK10529 DNA-binding transcrip  55.6     9.9 0.00022   29.0   2.2   18  127-144   191-208 (225)
 16 PF05528 Coronavirus_5:  Corona  54.4     2.2 4.8E-05   33.0  -1.4   18  147-164     5-25  (82)
 17 PF13495 Phage_int_SAM_4:  Phag  53.0      21 0.00046   24.3   3.3   53   59-141    24-77  (85)
 18 PRK11061 fused phosphoenolpyru  51.8      13 0.00029   37.0   3.0   36  127-162   475-531 (748)
 19 PRK00236 xerC site-specific ty  50.8      78  0.0017   24.9   6.6   37   57-94     31-67  (297)
 20 TIGR01417 PTS_I_fam phosphoeno  49.4      19 0.00041   34.9   3.5   38  127-164   308-367 (565)
 21 PRK10816 DNA-binding transcrip  47.5      14 0.00031   28.2   2.0   23  121-143   175-205 (223)
 22 COG4974 XerD Site-specific rec  46.4      21 0.00046   33.0   3.2   38   58-97     31-69  (300)
 23 PF06252 DUF1018:  Protein of u  45.9 1.2E+02  0.0025   23.2   6.8   87   60-161     2-89  (119)
 24 cd00801 INT_P4 Bacteriophage P  44.7      45 0.00098   27.3   4.6   26  126-152   135-163 (357)
 25 smart00259 ZnF_A20 A20-like zi  43.9      12 0.00027   23.0   0.9   16  103-118     7-22  (26)
 26 PF00486 Trans_reg_C:  Transcri  43.4      25 0.00053   23.5   2.4   21  126-146    44-64  (77)
 27 PF13276 HTH_21:  HTH-like doma  42.0      44 0.00096   22.3   3.5   29  129-162     4-32  (60)
 28 PF14768 RPA_interact_C:  Repli  40.0      27 0.00059   25.7   2.4   36  115-150    17-56  (82)
 29 PRK09279 pyruvate phosphate di  39.3      27 0.00058   36.1   3.0   36  135-170   636-685 (879)
 30 smart00862 Trans_reg_C Transcr  38.7      33 0.00072   22.7   2.5   19  126-144    45-63  (78)
 31 PRK06464 phosphoenolpyruvate s  37.2      42 0.00091   34.0   4.0   16  147-162   597-613 (795)
 32 PF11709 Mit_ribos_Mrp51:  Mito  35.0      52  0.0011   29.7   3.8   65   48-112   146-229 (312)
 33 PRK11177 phosphoenolpyruvate-p  35.0      35 0.00076   33.4   2.9   37  127-163   309-367 (575)
 34 TIGR01828 pyru_phos_dikin pyru  34.4      22 0.00048   36.4   1.5   25  146-170   652-679 (856)
 35 PF09107 SelB-wing_3:  Elongati  34.2      23 0.00049   24.4   1.1   21   79-99     21-41  (50)
 36 PF03344 Daxx:  Daxx Family;  I  33.7 1.5E+02  0.0032   30.3   7.1   75   53-168    66-140 (713)
 37 PF00140 Sigma70_r1_2:  Sigma-7  33.6      32 0.00069   22.0   1.7   12  154-165     2-13  (37)
 38 cd04372 RhoGAP_chimaerin RhoGA  33.4      47   0.001   27.2   3.1   36  130-165    45-87  (194)
 39 PF08544 GHMP_kinases_C:  GHMP   31.6     7.5 0.00016   26.4  -1.6   72   57-140     6-84  (85)
 40 PF09336 Vps4_C:  Vps4 C termin  31.4      44 0.00096   23.6   2.3   31   61-96     32-62  (62)
 41 smart00243 GAS2 Growth-Arrest-  31.3      32 0.00069   26.3   1.6   14   60-73     55-68  (73)
 42 PF03732 Retrotrans_gag:  Retro  31.1 1.3E+02  0.0027   20.2   4.4   38  121-163    56-94  (96)
 43 cd08793 Death_IRAK4 Death doma  30.5      58  0.0013   25.8   3.0   63   60-144    23-85  (100)
 44 cd04396 RhoGAP_fSAC7_BAG7 RhoG  30.2 1.8E+02  0.0039   24.6   6.1   37  129-165    60-103 (225)
 45 PRK05084 xerS site-specific ty  30.0 1.1E+02  0.0024   25.9   4.8   68   58-141    42-119 (357)
 46 PRK10701 DNA-binding transcrip  29.1      44 0.00096   26.0   2.1   16  127-142   201-216 (240)
 47 PF04221 RelB:  RelB antitoxin;  28.7 1.2E+02  0.0027   21.9   4.3   39  130-178    11-49  (83)
 48 cd04400 RhoGAP_fBEM3 RhoGAP_fB  27.8 1.2E+02  0.0026   24.6   4.5   39  126-165    49-94  (190)
 49 PF07700 HNOB:  Heme NO binding  27.6      25 0.00054   28.1   0.5   36   59-94     65-103 (171)
 50 PTZ00398 phosphoenolpyruvate c  27.6      98  0.0021   32.6   4.8   42  125-166   264-336 (974)
 51 cd00383 trans_reg_C Effector d  27.4      54  0.0012   22.5   2.1   20  126-145    62-81  (95)
 52 PF09958 DUF2192:  Uncharacteri  26.8      55  0.0012   29.4   2.6   21  127-147    27-47  (231)
 53 cd01355 AcnX Putative Aconitas  26.7      68  0.0015   30.4   3.3   54   82-147    48-108 (389)
 54 TIGR03190 benz_CoA_bzdN benzoy  26.7 4.9E+02   0.011   23.7   9.5   24   53-76    166-189 (377)
 55 COG0745 OmpR Response regulato  26.6      52  0.0011   28.0   2.3   28  119-146   177-212 (229)
 56 PRK11235 bifunctional antitoxi  26.1 1.3E+02  0.0029   22.7   4.2   38  130-177    11-48  (80)
 57 TIGR02249 integrase_gron integ  26.0 1.8E+02  0.0039   24.0   5.3   33   58-94     23-55  (315)
 58 KOG1452 Predicted Rho GTPase-a  26.0      37 0.00081   32.8   1.4   31  134-165   233-271 (442)
 59 cd04436 DEP_fRgd2 DEP (Disheve  26.0      50  0.0011   25.5   1.9   40   62-101    33-76  (84)
 60 cd01187 INT_SG4 INT_SG4, DNA b  25.6 2.9E+02  0.0063   22.5   6.4   29   60-92     25-53  (299)
 61 cd04388 RhoGAP_p85 RhoGAP_p85:  25.2      74  0.0016   27.2   3.0   34  132-165    45-82  (200)
 62 PF09674 DUF2400:  Protein of u  25.1      63  0.0014   28.5   2.6   52  122-173    24-94  (232)
 63 PF10780 MRP_L53:  39S ribosoma  25.0      37  0.0008   23.6   0.9   25  149-174     2-28  (51)
 64 PF00179 UQ_con:  Ubiquitin-con  25.0 1.7E+02  0.0036   22.4   4.6   45  124-171    90-137 (140)
 65 PRK09468 ompR osmolarity respo  24.7      59  0.0013   25.2   2.1   17  127-143   201-217 (239)
 66 PRK11173 two-component respons  24.1      62  0.0013   25.3   2.1   19  127-145   200-218 (237)
 67 PF06947 DUF1290:  Protein of u  23.7      67  0.0014   25.3   2.2   17  126-142    16-32  (88)
 68 PF02187 GAS2:  Growth-Arrest-S  23.6      18  0.0004   27.3  -0.9   13   61-73     56-68  (73)
 69 PF00667 FAD_binding_1:  FAD bi  23.5      71  0.0015   26.4   2.5   45   82-126    56-100 (219)
 70 COG4865 Glutamate mutase epsil  23.4      54  0.0012   32.1   2.0   22  131-152   196-217 (485)
 71 PF10520 Kua-UEV1_localn:  Kua-  23.3      39 0.00085   28.8   1.0   24  124-147    17-41  (178)
 72 PF07535 zf-DBF:  DBF zinc fing  23.2      41 0.00088   23.4   0.9   12  125-136    37-48  (49)
 73 TIGR02384 RelB_DinJ addiction   23.1 1.8E+02   0.004   21.5   4.4   39  130-178    12-50  (83)
 74 PF06480 FtsH_ext:  FtsH Extrac  22.9 1.1E+02  0.0023   21.2   2.9   26  125-150    84-109 (110)
 75 cd04383 RhoGAP_srGAP RhoGAP_sr  22.9      97  0.0021   25.4   3.2   35  130-165    47-88  (188)
 76 KOG3816 Cell differentiation r  22.8   1E+02  0.0022   30.6   3.7   83   63-160   274-369 (526)
 77 cd04379 RhoGAP_SYD1 RhoGAP_SYD  22.7      97  0.0021   26.1   3.2   39  126-165    44-89  (207)
 78 PF01663 Phosphodiest:  Type I   22.6      65  0.0014   26.7   2.1   27  121-147   208-234 (365)
 79 cd04399 RhoGAP_fRGD2 RhoGAP_fR  22.3      90  0.0019   26.3   2.9   35  130-165    51-94  (212)
 80 PF12067 Sox_C_TAD:  Sox C-term  21.8      49  0.0011   28.8   1.3   17   57-73    139-155 (197)
 81 PRK13977 myosin-cross-reactive  21.8 1.1E+02  0.0023   30.6   3.7  101   59-177   160-270 (576)
 82 cd04390 RhoGAP_ARHGAP22_24_25   21.5 1.4E+02   0.003   24.4   3.8   37  129-165    50-90  (199)
 83 cd08802 Death_UNC5B Death doma  20.9      59  0.0013   24.9   1.4   17  129-145    60-76  (84)
 84 cd08782 Death_DAPK1 Death doma  20.8      52  0.0011   24.5   1.1   28  118-145    47-75  (82)
 85 PF01754 zf-A20:  A20-like zinc  20.6      43 0.00092   20.7   0.5   16  102-117     5-20  (25)
 86 PF13099 DUF3944:  Domain of un  20.6      54  0.0012   21.9   1.0   22   78-99     11-34  (35)
 87 cd04406 RhoGAP_myosin_IXA RhoG  20.5 1.1E+02  0.0023   25.2   2.9   36  130-165    44-83  (186)
 88 PF12055 DUF3536:  Domain of un  20.4      74  0.0016   29.2   2.1   42  120-166     8-49  (285)
 89 cd08799 Death_UNC5C Death doma  20.4      54  0.0012   25.0   1.1   17  129-145    60-76  (84)
 90 PF00618 RasGEF_N:  RasGEF N-te  20.2      61  0.0013   23.2   1.3   12  125-136     4-15  (104)
 91 PF10774 DUF4226:  Domain of un  20.1 1.5E+02  0.0032   23.7   3.5   34  127-161    48-81  (112)
 92 KOG4329 DNA-binding protein [G  20.1      57  0.0012   31.8   1.4   31   80-111   211-241 (445)

No 1  
>PF04852 DUF640:  Protein of unknown function (DUF640);  InterPro: IPR006936 This conserved region is found in plant proteins including the resistance protein-like protein (O49468 from SWISSPROT).
Probab=100.00  E-value=6.5e-76  Score=471.83  Aligned_cols=122  Identities=85%  Similarity=1.501  Sum_probs=119.0

Q ss_pred             CCCCCCchHHHhhhhhhhHHHHHHHhcCCCCccccCcchhHHHHHHhhcccCcccccCCCCCCCCCCCCCCCCCCchhhh
Q 046561           45 AATSSSSRYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHPNPPAPCPCPLRQA  124 (204)
Q Consensus        45 ~~~~~~SrYesQKRrdwntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfGkTkVH~~~C~ffG~p~ppapC~CPlRQA  124 (204)
                      .+++.+||||+|||||||||+|||+||+|||+|++|+|+|||+||+|+|||||||||.++|+|||+|+||+||+||||||
T Consensus        11 ~~~~~~SrYesQKrrdwntf~qyL~n~rPP~~L~~csg~hVl~FL~~~d~~GkTkVh~~~C~~~g~~~~p~~C~CPlrqA   90 (132)
T PF04852_consen   11 SPQPAPSRYESQKRRDWNTFGQYLRNHRPPLSLSRCSGNHVLEFLRYLDQFGKTKVHGQGCPFFGHPSPPAPCPCPLRQA   90 (132)
T ss_pred             CCCCCCcccchhhhHHHHHHHHHHHccCCCcchhhcChHHHHHHHHHHhccCCeeecCCCCCCCCCCCCCCCCCCcHHHH
Confidence            34567899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cchhHHHHHHHHHHHHHhCCCCCCCccchhhHHHHHHHHhhH
Q 046561          125 WGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDV  166 (204)
Q Consensus       125 wGSLDALIGRLRAafEE~Gg~pE~NPF~araVRlYLReVRd~  166 (204)
                      ||||||||||||||||||||+||+|||+++|||+|||||||+
T Consensus        91 wGSlDalIGrLraafee~Gg~pe~NPf~~~~vr~yLr~vr~~  132 (132)
T PF04852_consen   91 WGSLDALIGRLRAAFEEHGGHPEANPFAARAVRLYLREVRDS  132 (132)
T ss_pred             hccHHHHHHHHHHHHHHhCCCCCCCchhhHHHHHHHHHHhcC
Confidence            999999999999999999999999999999999999999985


No 2  
>PF08821 CGGC:  CGGC domain;  InterPro: IPR014925 Proteins in this entry are a quite highly conserved sequence of CGGC in its central region. The region has many conserved cysteines and histidines suggestive of a zinc binding function. 
Probab=91.70  E-value=0.33  Score=37.79  Aligned_cols=67  Identities=22%  Similarity=0.545  Sum_probs=49.5

Q ss_pred             HHHHHHHhcCCCCccccCc---chhHHHHHHhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHHHHHHH
Q 046561           63 TFGQYLKNHRPPLSLSRCS---GAHVLEFLRYLDQFGKTKVHTPICPFYGHPNPPAPCPCPLRQAWGSLDALIGRLRAAF  139 (204)
Q Consensus        63 tf~qyL~n~rPPlsL~~cs---g~hVleFLrylDqfGkTkVH~~~C~ffG~p~ppapC~CPlRQAwGSLDALIGRLRAaf  139 (204)
                      .|.+|=.+..--+.+.+|.   +..|+..++.+-..|-..||...|.+.+.+.+    +||.      +|.|+-.|+++|
T Consensus        29 ~F~~y~~~~~elvgf~~CgGCpg~~~~~~~~~l~~~~~d~IHlssC~~~~~~~~----~CP~------~~~~~~~I~~~~   98 (107)
T PF08821_consen   29 AFARYDDEDVELVGFFTCGGCPGRKLVRRIKKLKKNGADVIHLSSCMVKGNPHG----PCPH------IDEIKKIIEEKF   98 (107)
T ss_pred             ccccCCCCCeEEEEEeeCCCCChhHHHHHHHHHHHCCCCEEEEcCCEecCCCCC----CCCC------HHHHHHHHHHHh
Confidence            3444433222233444554   68899999999999999999999999987653    6665      899999999888


No 3  
>PF02899 Phage_int_SAM_1:  Phage integrase, N-terminal SAM-like domain;  InterPro: IPR004107 Proteins containing this domain cleave DNA substrates by a series of staggered cuts, during which the protein becomes covalently linked to the DNA through a catalytic tyrosine residue at the carboxy end of the alignment [, ].  The phage integrase N-terminal SAM-like domain is almost always found with the signature that defines the phage integrase family (see IPR002104 from INTERPRO).; GO: 0003677 DNA binding, 0015074 DNA integration; PDB: 1Z1G_B 1Z19_A 1Z1B_A 2OXO_A 1P7D_B 3NRW_A 1A0P_A.
Probab=90.10  E-value=0.54  Score=31.78  Aligned_cols=40  Identities=28%  Similarity=0.465  Sum_probs=31.8

Q ss_pred             hhhhhhhHHHHHHHhcCCCCccccCcchhHHHHHHhhcccC
Q 046561           56 QKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFG   96 (204)
Q Consensus        56 QKRrdwntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfG   96 (204)
                      .-+++++.|.+||.+ ....++..++..||.+|+.++-+.|
T Consensus        21 ~Y~~~l~~f~~~~~~-~~~~~~~~i~~~~v~~f~~~~~~~~   60 (84)
T PF02899_consen   21 SYRRDLRRFIRWLEE-HGIIDWEDITEEDVRDFLEYLAKEG   60 (84)
T ss_dssp             HHHHHHHHHHHHHHH-TTS-CGGG--HHHHHHHHHHHHCTT
T ss_pred             HHHHHHHHHHHhhhh-hhhhhhhhhhhHHHHHHHHHHHccC
Confidence            456789999999999 5667788899999999999998766


No 4  
>cd00798 INT_XerDC XerD and XerC integrases, DNA breaking-rejoining enzymes, N- and C-terminal domains. XerD-like integrases are involved in the site-specific integration and excision of lysogenic bacteriophage genomes, transposition of conjugative transposons, termination of chromosomal replication, and stable plasmid inheritance. They share the same fold in their catalytic domain containing six conserved active site residues and the overall reaction mechanism with the DNA breaking-rejoining enzyme superfamily.  In Escherichia coli, the Xer site-specific recombination system acts to convert dimeric chromosomes, which are formed by homologous recombination to monomers. Two related recombinases, XerC and XerD, bind cooperatively to a recombination site present in the E. coli chromosome. Each recombinase catalyzes the exchange of one pair of DNA strand in a reaction that proceeds through a Holliday junction intermediate. These enzymes can bridge two different and well-separated DNA sequen
Probab=87.66  E-value=2.4  Score=32.86  Aligned_cols=69  Identities=25%  Similarity=0.269  Sum_probs=48.3

Q ss_pred             hhhhhhhHHHHHHHhcCCCCccccCcchhHHHHHHhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHHH
Q 046561           56 QKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHPNPPAPCPCPLRQAWGSLDALIGRL  135 (204)
Q Consensus        56 QKRrdwntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfGkTkVH~~~C~ffG~p~ppapC~CPlRQAwGSLDALIGRL  135 (204)
                      +-+..|+.|.+|+....... +..-+..||.+|+.++.+.|                          ....++...++-|
T Consensus        21 ~~~~~~~~~~~~~~~~~~~~-~~~l~~~~i~~~~~~~~~~~--------------------------~~~~t~~~~~~~l   73 (284)
T cd00798          21 AYRRDLERFLEFLEERGILF-PADVTPDDIRRFLAELKDQG--------------------------LSARSIARKLSAL   73 (284)
T ss_pred             HHHHHHHHHHHHHHHcCCCc-hhhCCHHHHHHHHHHhhhcC--------------------------CCHHHHHHHHHHH
Confidence            44567899999998754433 56678899999999887644                          1335777788888


Q ss_pred             HHHHHHhC--CCCCCCcc
Q 046561          136 RAAFEENG--GKPEANPF  151 (204)
Q Consensus       136 RAafEE~G--g~pE~NPF  151 (204)
                      +++|.-..  +--+.||+
T Consensus        74 ~~~~~~~~~~~~~~~~p~   91 (284)
T cd00798          74 RSFFKFLLREGLILANPA   91 (284)
T ss_pred             HHHHHHHHHcCCccCChh
Confidence            88887322  33456777


No 5  
>cd00799 INT_Cre Cre recombinase, C-terminal catalytic domain.  Cre-like recombinases belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism.  The bacteriophage P1 Cre recombinase maintains the circular phage replicon in a monomeric state by catalyzing a site-specific recombination between two loxP sites.  The catalytic core domain of Cre recombinase is linked to a more divergent helical N-terminal domain, which interacts primarily with the DNA major groove proximal to the crossover region.
Probab=85.98  E-value=7.4  Score=31.51  Aligned_cols=77  Identities=23%  Similarity=0.312  Sum_probs=52.6

Q ss_pred             hhhhhhhHHHHHHHhcCCCCccccCcchhHHHHHHhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHHH
Q 046561           56 QKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHPNPPAPCPCPLRQAWGSLDALIGRL  135 (204)
Q Consensus        56 QKRrdwntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfGkTkVH~~~C~ffG~p~ppapC~CPlRQAwGSLDALIGRL  135 (204)
                      .-..+++.|..|+..+.  +....-+..+|.+|+.||.+.                           .+..++-..++.|
T Consensus         6 ~y~~~l~~f~~~~~~~~--~~~~~~~~~~i~~~~~~l~~~---------------------------~s~~ti~~~~~~l   56 (287)
T cd00799           6 AYLSDWRRFAAWCQAHG--RTPLPASPETVTLYLTDLADS---------------------------LAPSTISRRLSAL   56 (287)
T ss_pred             HHHHHHHHHHHHHHhcC--CCCCCCCHHHHHHHHHHHHhc---------------------------cChHHHHHHHHHH
Confidence            44568889999998752  222234589999999988531                           1456888899999


Q ss_pred             HHHHHHhCCCCCCCccchhhHHHHHHHHh
Q 046561          136 RAAFEENGGKPEANPFGARAVRLYLREVR  164 (204)
Q Consensus       136 RAafEE~Gg~pE~NPF~araVRlYLReVR  164 (204)
                      +.+|+..+.   .||+....++.-|+.++
T Consensus        57 ~~~~~~~~~---~~p~~~~~~~~~~~~~~   82 (287)
T cd00799          57 SQLHRRSGL---PSPADSPLVRLVLRGIR   82 (287)
T ss_pred             HHHHHHcCC---CCCccCHHHHHHHHHHH
Confidence            999985433   58876555555555554


No 6  
>TIGR02225 recomb_XerD tyrosine recombinase XerD. The phage integrase family describes a number of recombinases with tyrosine active sites that transiently bind covalently to DNA. Many are associated with mobile DNA elements, including phage, transposons, and phase variation loci. This model represents XerD, one of two closely related chromosomal proteins along with XerC (TIGR02224). XerC and XerD are site-specific recombinases which help resolve chromosome dimers to monomers for cell division after DNA replication. In species with a large chromosome and with homologs of XerD on other replicons, the chomosomal copy was preferred for building this model. This model does not detect all XerD, as some apparent XerD examples score below the trusted and noise cutoff scores. XerC and XerD interact with cell division protein FtsK.
Probab=83.84  E-value=4.5  Score=31.70  Aligned_cols=70  Identities=23%  Similarity=0.393  Sum_probs=47.7

Q ss_pred             HhhhhhhhHHHHHHHhcCCCCccccCcchhHHHHHHhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHH
Q 046561           55 NQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHPNPPAPCPCPLRQAWGSLDALIGR  134 (204)
Q Consensus        55 sQKRrdwntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfGkTkVH~~~C~ffG~p~ppapC~CPlRQAwGSLDALIGR  134 (204)
                      .+-+..++.|..|+....  ..+..-+..||.+|+.++.+.|                          .+.-++...+..
T Consensus        19 ~~~~~~~~~~~~~~~~~~--~~~~~it~~~i~~~~~~~~~~~--------------------------~~~~t~~~~~~~   70 (291)
T TIGR02225        19 EAYRRDLEKFLEFLEERG--IDLEEVDRGDIVDFLAELKEAG--------------------------LSARSIARALSA   70 (291)
T ss_pred             HHHHHHHHHHHHHHHhcC--CChHHCCHHHHHHHHHHhhcCC--------------------------CCHhHHHHHHHH
Confidence            445567888999998542  2455567899999999887644                          122367888999


Q ss_pred             HHHHHHHh--CCCCCCCccc
Q 046561          135 LRAAFEEN--GGKPEANPFG  152 (204)
Q Consensus       135 LRAafEE~--Gg~pE~NPF~  152 (204)
                      |+++|+-.  -+--+.|||.
T Consensus        71 l~~~~~~a~~~~~~~~np~~   90 (291)
T TIGR02225        71 LRSFYRFLLREGIREDDPSA   90 (291)
T ss_pred             HHHHHHHHHhcccccCCchh
Confidence            99988732  2334568863


No 7  
>PRK00283 xerD site-specific tyrosine recombinase XerD; Reviewed
Probab=83.20  E-value=3.6  Score=32.79  Aligned_cols=68  Identities=26%  Similarity=0.289  Sum_probs=47.6

Q ss_pred             hhhhhhHHHHHHHhcCCCCccccCcchhHHHHHHhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHHHH
Q 046561           57 KRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHPNPPAPCPCPLRQAWGSLDALIGRLR  136 (204)
Q Consensus        57 KRrdwntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfGkTkVH~~~C~ffG~p~ppapC~CPlRQAwGSLDALIGRLR  136 (204)
                      -+.+|+.|..||..+.-  .+...+..||.+|+.++.+.|                          .+-.++...+..|+
T Consensus        30 ~~~~~~~~~~~~~~~~~--~~~~l~~~~i~~~~~~~~~~~--------------------------~~~~t~~~~~~~l~   81 (299)
T PRK00283         30 YRRDLELFAEWLAARGL--SLAEATRDDLQAFLAELAEGG--------------------------YKATSSARRLSALR   81 (299)
T ss_pred             HHHHHHHHHHHHHhcCC--ChHHCCHHHHHHHHHHHHhCC--------------------------CCHHHHHHHHHHHH
Confidence            45688899999986532  566778999999999885432                          23457778888888


Q ss_pred             HHHHHhC--CCCCCCccc
Q 046561          137 AAFEENG--GKPEANPFG  152 (204)
Q Consensus       137 AafEE~G--g~pE~NPF~  152 (204)
                      ++|+-..  +--..|||.
T Consensus        82 ~~~~~a~~~~~i~~np~~   99 (299)
T PRK00283         82 RFFQFLLREGLREDDPSA   99 (299)
T ss_pred             HHHHHHHHcCCcccCchh
Confidence            8887331  234468863


No 8  
>COG1080 PtsA Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) [Carbohydrate transport and metabolism]
Probab=79.76  E-value=2.4  Score=42.00  Aligned_cols=42  Identities=43%  Similarity=0.660  Sum_probs=33.1

Q ss_pred             hhhcchhHHHHHHHHHHHHHhCCC--------------------C-CCCcc-chhhHHHHHHHH
Q 046561          122 RQAWGSLDALIGRLRAAFEENGGK--------------------P-EANPF-GARAVRLYLREV  163 (204)
Q Consensus       122 RQAwGSLDALIGRLRAafEE~Gg~--------------------p-E~NPF-~araVRlYLReV  163 (204)
                      |..|=+.|..----++..|.+||+                    | |.||| |-|+||+||...
T Consensus       305 r~~~P~EeEQ~~aY~~vlea~~g~pviiRTlDiGGDK~lpyl~lp~E~NPfLG~RaIRl~l~~~  368 (574)
T COG1080         305 RDALPDEEEQFEAYKAVLEAMGGKPVIIRTLDIGGDKPLPYLNLPKEENPFLGYRAIRLSLERP  368 (574)
T ss_pred             CCCCCChHHHHHHHHHHHHHcCCCceEEEecccCCCCcCCCCCCccccCchhhhHHHHHhhccH
Confidence            345556777777778888888887                    3 79999 899999999643


No 9  
>TIGR02224 recomb_XerC tyrosine recombinase XerC. The phage integrase family describes a number of recombinases with tyrosine active sites that transiently bind covalently to DNA. Many are associated with mobile DNA elements, including phage, transposons, and phase variation loci. This model represents XerC, one of two closely related chromosomal proteins along with XerD (TIGR02225). XerC and XerD are site-specific recombinases which help resolve chromosome dimers to monomers for cell division after DNA replication. In species with a large chromosome and homologs of XerC on other replicons, the chomosomal copy was preferred for building this model. This model does not detect all XerC, as some apparent XerC examples score in the gray zone between trusted (450) and noise (410) cutoffs, along with some XerD examples. XerC and XerD interact with cell division protein FtsK.
Probab=73.96  E-value=13  Score=29.34  Aligned_cols=69  Identities=29%  Similarity=0.351  Sum_probs=46.8

Q ss_pred             hhhhhHHHHHHHhcCCCCccccCcchhHHHHHHhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHHHHH
Q 046561           58 RRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHPNPPAPCPCPLRQAWGSLDALIGRLRA  137 (204)
Q Consensus        58 Rrdwntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfGkTkVH~~~C~ffG~p~ppapC~CPlRQAwGSLDALIGRLRA  137 (204)
                      +.+++.|.+||......+.+..-+..||.+|+.++.+.|.                          +..++...++.||+
T Consensus        22 ~~~~~~~~~~~~~~~~~~~~~~l~~~~i~~~~~~~~~~~~--------------------------~~~T~~~~~~~l~~   75 (295)
T TIGR02224        22 RRDLKAFLEFLEEEGGLASLAEVTAADLRSFLAELHARGL--------------------------SRRSLARKLSALRS   75 (295)
T ss_pred             HHHHHHHHHHHHhcCCCCccccCcHHHHHHHHHHhcccCC--------------------------CHHHHHHHHHHHHH
Confidence            4466678888888665677888889999999998765321                          22456677777887


Q ss_pred             HHHHhC--CCCCCCccc
Q 046561          138 AFEENG--GKPEANPFG  152 (204)
Q Consensus       138 afEE~G--g~pE~NPF~  152 (204)
                      +|.-..  +.-+.|||.
T Consensus        76 ~~~~a~~~~~~~~np~~   92 (295)
T TIGR02224        76 FYRFLVRRGLIKANPAA   92 (295)
T ss_pred             HHHHHHHcCccccChHh
Confidence            776421  223467763


No 10 
>PF10865 DUF2703:  Domain of unknown function (DUF2703);  InterPro: IPR021219  This family of protein has no known function. 
Probab=63.29  E-value=2.2  Score=34.21  Aligned_cols=43  Identities=26%  Similarity=0.297  Sum_probs=32.7

Q ss_pred             HHHHHHhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHHHHHHHHHhCCCCC
Q 046561           85 VLEFLRYLDQFGKTKVHTPICPFYGHPNPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPE  147 (204)
Q Consensus        85 VleFLrylDqfGkTkVH~~~C~ffG~p~ppapC~CPlRQAwGSLDALIGRLRAafEE~Gg~pE  147 (204)
                      +|+|+ |||..|+|      |...             ...+.+|+..+-+|+.+|+..|..++
T Consensus         2 ~I~w~-~l~~~g~t------C~RC-------------~~Tg~~L~~av~~l~~~L~~~Giev~   44 (120)
T PF10865_consen    2 VIEWQ-HLDLDGKT------CERC-------------GDTGETLREAVKELAPVLAPLGIEVR   44 (120)
T ss_pred             eEEEE-EeecCCCc------CCch-------------hhHHHHHHHHHHHHHHHHHhCCcEEE
Confidence            46777 55555776      5443             36678999999999999999998754


No 11 
>TIGR01418 PEP_synth phosphoenolpyruvate synthase. Also called pyruvate,water dikinase and PEP synthase. The member from Methanococcus jannaschii contains a large intein. This enzyme generates phosphoenolpyruvate (PEP) from pyruvate, hydrolyzing ATP to AMP and releasing inorganic phosphate in the process. The enzyme shows extensive homology to other enzymes that use PEP as substrate or product. This enzyme may provide PEP for gluconeogenesis, for PTS-type carbohydrate transport systems, or for other processes.
Probab=62.61  E-value=12  Score=37.60  Aligned_cols=42  Identities=26%  Similarity=0.309  Sum_probs=30.5

Q ss_pred             HHHHHHHHHHHHHhCCC-------------------------CCCCcc-chhhHHHHH----HHHhhHHHhh
Q 046561          129 DALIGRLRAAFEENGGK-------------------------PEANPF-GARAVRLYL----REVRDVQSKA  170 (204)
Q Consensus       129 DALIGRLRAafEE~Gg~-------------------------pE~NPF-~araVRlYL----ReVRd~QAkA  170 (204)
                      |.+.-.+|.+++.++++                         .|.||| |.|.||+||    .++=+.|.+|
T Consensus       547 ~~~~~~y~~i~~~~~~~pV~iRtlD~~~dk~~~~~ggdk~~~~E~NP~LG~RGir~~l~~~~~~lf~~qlra  618 (782)
T TIGR01418       547 DKLAEGIAKVAAAFYPKPVIVRTSDFKSNEYRNLIGGEEYEPDEENPMLGWRGASRYYSESYEEAFRLECRA  618 (782)
T ss_pred             HHHHHHHHHHHHHcCCCeEEEEcCCCCccchhhhhCCCccCCCCCCcccccchhhhhcccccHHHHHHHHHH
Confidence            55566777888776544                         378999 889999999    4466666554


No 12 
>PF00539 Tat:  Transactivating regulatory protein (Tat);  InterPro: IPR001831 Like other lentiviruses, Human immunodeficiency virus 1 (HIV-1) encodes a trans-activating regulatory protein (Tat), which is essential for efficient transcription of the viral genome [, ]. Tat acts by binding to an RNA stem-loop structure, the trans-activating response element (TAR), found at the 5' ends of nascent HIV-1 transcripts. In binding to TAR, Tat alters the properties of the transcription complex, recruits a positive transcription elongation complex (P-TEFb) and hence increases the production of full-length viral RNA []. Tat protein also associates with RNA polymerase II complexes during early transcription elongation after the promoter clearance and before the synthesis of full-length TAR RNA transcript. This interaction of Tat with RNA polymerase II elongation complexes is P-TEFb-independent. There are two Tat binding sites on each transcription elongation complex; one is located on TAR RNA and the other one on RNA polymerase II near the exit site for nascent mRNA transcripts which suggests that two Tat molecules are involved in performing various functions during a single round of HIV-1 mRNA synthesis [].  The minimum Tat sequence that can mediate specific TAR binding in vitro has been mapped to a basic domain of 10 amino acids, comprising mostly Arg and Lys residues. Regulatory activity, however, also requires the 47 N-terminal residues, which interact with components of the transcription complex and function as a transcriptional activation domain [, , ].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0042025 host cell nucleus; PDB: 2W2H_D 1ZBN_B 1TVS_A 1TVT_A 3O6L_C 3O6M_C 3MI9_C 3MIA_C 1JFW_A 1TBC_A ....
Probab=61.49  E-value=3  Score=31.20  Aligned_cols=19  Identities=47%  Similarity=0.770  Sum_probs=14.4

Q ss_pred             HhhhccchhhhhcCCCCCc
Q 046561          168 SKARGISYEKKKRKRPPQQ  186 (204)
Q Consensus       168 AkARgi~y~kkkrkr~~~~  186 (204)
                      .|+-||.|..|||||..++
T Consensus        45 ~KgLGI~Y~r~rrRrr~~~   63 (68)
T PF00539_consen   45 QKGLGISYGRKRRRRRTPQ   63 (68)
T ss_dssp             CTSSSTSSSSSSCSCCCSS
T ss_pred             eCCCcccccccccCcCCCC
Confidence            4788999998777665544


No 13 
>PF02896 PEP-utilizers_C:  PEP-utilising enzyme, TIM barrel domain;  InterPro: IPR000121 A number of enzymes that catalyze the transfer of a phosphoryl group from phosphoenolpyruvate (PEP) via a phospho-histidine intermediate have been shown to be structurally related [, , , ]. All these enzymes share the same catalytic mechanism: they bind PEP and transfer the phosphoryl group from it to a histidine residue. The sequence around that residue is highly conserved. This domain is often found associated with the pyruvate phosphate dikinase, PEP/pyruvate-binding domain (IPR002192 from INTERPRO) at its N terminus and the PEP-utilizing enzyme mobile domain.; GO: 0016772 transferase activity, transferring phosphorus-containing groups, 0016310 phosphorylation; PDB: 2HRO_A 2OLS_A 2DIK_A 2R82_A 1JDE_A 1DIK_A 1GGO_A 1KBL_A 1KC7_A 2BG5_B ....
Probab=59.97  E-value=14  Score=33.28  Aligned_cols=46  Identities=28%  Similarity=0.271  Sum_probs=33.7

Q ss_pred             cchhHHHHHHHHHHHHHhCCC----------------------CCCCcc-chhhHHHHHHHHhhHHHhh
Q 046561          125 WGSLDALIGRLRAAFEENGGK----------------------PEANPF-GARAVRLYLREVRDVQSKA  170 (204)
Q Consensus       125 wGSLDALIGRLRAafEE~Gg~----------------------pE~NPF-~araVRlYLReVRd~QAkA  170 (204)
                      +=+.|.+...++.+.+.++++                      .|.||| |-|+||+||..-.-...+-
T Consensus        58 ~p~e~eq~~~y~~i~~~~~~~pV~iRtlD~g~dK~l~~~~~~~~E~NP~LG~RGiR~~l~~p~~f~~Ql  126 (293)
T PF02896_consen   58 PPSEEEQYEIYRKIAEAMGGKPVTIRTLDIGGDKPLPYLSREPKEENPALGLRGIRRSLAHPELFRTQL  126 (293)
T ss_dssp             HHHHHHHHHHHHHHHHHTTTSEEEEE---SBCCCGSCSSHHCH--SSGGGSSBTHHHHHHSHHHHHHHH
T ss_pred             CchHHHHHHHHHHHHHHhccCcEEEEecCCCCCccCCcccccccccccccccccccccccchhhHHHHH
Confidence            346788889999999988876                      569998 8899999997644333333


No 14 
>cd01185 INT_Tn4399 Tn4399 and related integrases, DNA breaking-rejoining enzymes, integrase/recombinases, N- and C-terminal domains. This CD includes various bacterial integrases, including cLV25, a Bacteroides fragilis chromosomal transfer factor integrase similar to the Bacteroides mobilizable transposon, Tn4399, integrase.
Probab=59.94  E-value=38  Score=27.49  Aligned_cols=34  Identities=15%  Similarity=0.344  Sum_probs=26.7

Q ss_pred             hhhhHHHHHHHhcCC--CCccccCcchhHHHHHHhh
Q 046561           59 RDWNTFGQYLKNHRP--PLSLSRCSGAHVLEFLRYL   92 (204)
Q Consensus        59 rdwntf~qyL~n~rP--PlsL~~csg~hVleFLryl   92 (204)
                      ..++.|..||....+  .+.+..-+..||.+|+.|+
T Consensus        43 ~~~~~~~~~~~~~~~~~~~~l~~i~~~~i~~~~~~l   78 (299)
T cd01185          43 THLKNLREFIECTYKEIDIALLELTREFILEFKLFL   78 (299)
T ss_pred             HHHHHHHHHHHHhcCccCCCHHHccHHHHHHHHHHH
Confidence            346678888876554  6678888899999999998


No 15 
>PRK10529 DNA-binding transcriptional activator KdpE; Provisional
Probab=55.59  E-value=9.9  Score=29.00  Aligned_cols=18  Identities=28%  Similarity=0.504  Sum_probs=14.4

Q ss_pred             hhHHHHHHHHHHHHHhCC
Q 046561          127 SLDALIGRLRAAFEENGG  144 (204)
Q Consensus       127 SLDALIGRLRAafEE~Gg  144 (204)
                      +||.+|.|||.-+++.+.
T Consensus       191 ~~~~~i~rlR~kl~~~~~  208 (225)
T PRK10529        191 YLRIYMGHLRQKLEQDPA  208 (225)
T ss_pred             CHHHHHHHHHHHhccCCC
Confidence            589999999999976443


No 16 
>PF05528 Coronavirus_5:  Coronavirus gene 5 protein;  InterPro: IPR008458 Infectious bronchitis virus, a member of Coronaviridae family, has a single-stranded positive-sense RNA genome, which is 27 kb in length. Gene 5 contains two (5a and 5b) open reading frames. The function of the 5a and 5b proteins is unknown [].
Probab=54.45  E-value=2.2  Score=32.97  Aligned_cols=18  Identities=56%  Similarity=0.809  Sum_probs=14.7

Q ss_pred             CCCcc---chhhHHHHHHHHh
Q 046561          147 EANPF---GARAVRLYLREVR  164 (204)
Q Consensus       147 E~NPF---~araVRlYLReVR  164 (204)
                      .+|||   .||-+|+||||=-
T Consensus         5 k~NPfr~aiARKaRiyLr~Gl   25 (82)
T PF05528_consen    5 KDNPFRGAIARKARIYLREGL   25 (82)
T ss_pred             ccCchhhhhhhheeeeeecCC
Confidence            48999   5789999999743


No 17 
>PF13495 Phage_int_SAM_4:  Phage integrase, N-terminal SAM-like domain; PDB: 2A3V_A.
Probab=52.95  E-value=21  Score=24.26  Aligned_cols=53  Identities=19%  Similarity=0.359  Sum_probs=32.5

Q ss_pred             hhhhHHHHHHHhcCCCCccccCcchhHHHHHHhhc-ccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHHHHH
Q 046561           59 RDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLD-QFGKTKVHTPICPFYGHPNPPAPCPCPLRQAWGSLDALIGRLRA  137 (204)
Q Consensus        59 rdwntf~qyL~n~rPPlsL~~csg~hVleFLrylD-qfGkTkVH~~~C~ffG~p~ppapC~CPlRQAwGSLDALIGRLRA  137 (204)
                      ...+.|.+|+.+.    .+...+..||.+||.||- .-|                          .+..++...+.-||.
T Consensus        24 ~~l~~f~~~~~~~----~~~~it~~~i~~y~~~l~~~~~--------------------------~s~~T~~~~~~~l~~   73 (85)
T PF13495_consen   24 YHLKRFLRFLGNK----PPDEITPEDIEQYLNYLQNERG--------------------------LSPSTINQYLSALRS   73 (85)
T ss_dssp             HHHHHHHTTSSS------GGG--HHHHHHHHHHHHTTT-----------------------------HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHcccC----ccchhHHHHHHHHHHHHHHhcC--------------------------CCHHHHHHHHHHHHH
Confidence            4456677777633    456678999999999887 322                          345566777777777


Q ss_pred             HHHH
Q 046561          138 AFEE  141 (204)
Q Consensus       138 afEE  141 (204)
                      .|+-
T Consensus        74 ff~~   77 (85)
T PF13495_consen   74 FFRW   77 (85)
T ss_dssp             HHHC
T ss_pred             HHHH
Confidence            7663


No 18 
>PRK11061 fused phosphoenolpyruvate-protein phosphotransferase PtsP/GAF domain; Provisional
Probab=51.79  E-value=13  Score=37.03  Aligned_cols=36  Identities=25%  Similarity=0.410  Sum_probs=29.6

Q ss_pred             hhHHHHHHHHHHHHHhCCC--------------------CCCCcc-chhhHHHHHHH
Q 046561          127 SLDALIGRLRAAFEENGGK--------------------PEANPF-GARAVRLYLRE  162 (204)
Q Consensus       127 SLDALIGRLRAafEE~Gg~--------------------pE~NPF-~araVRlYLRe  162 (204)
                      +-|......|.+.+.++++                    +|.||| |.|+||+||+.
T Consensus       475 ~e~eQ~~~y~~~~~~~~~~pv~iRtlDiGgDK~~~~~~~~E~NP~lG~RgiR~~l~~  531 (748)
T PRK11061        475 SEEEQVAQYQGMLQMFPDKPVTLRTLDIGADKQLPYMPISEENPCLGWRGIRITLDQ  531 (748)
T ss_pred             CHHHHHHHHHHHHHHcCCCeEEEECCCCCcCCCCCCCCCCCCCcccccchhhccccC
Confidence            4677888888888888765                    589999 78999999853


No 19 
>PRK00236 xerC site-specific tyrosine recombinase XerC; Reviewed
Probab=50.79  E-value=78  Score=24.85  Aligned_cols=37  Identities=30%  Similarity=0.379  Sum_probs=27.5

Q ss_pred             hhhhhhHHHHHHHhcCCCCccccCcchhHHHHHHhhcc
Q 046561           57 KRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQ   94 (204)
Q Consensus        57 KRrdwntf~qyL~n~rPPlsL~~csg~hVleFLrylDq   94 (204)
                      -+.+|+.|..|+..... ..+..-...||.+||.++-+
T Consensus        31 ~~~~~~~~~~~~~~~~~-~~~~~i~~~~i~~~~~~~~~   67 (297)
T PRK00236         31 YRRDLRAFLAFLEEHGI-SSLQDLDAADLRSFLARRRR   67 (297)
T ss_pred             HHHHHHHHHHHHHHcCC-CchhhCCHHHHHHHHHHHHh
Confidence            34677888888887543 55667778999999987754


No 20 
>TIGR01417 PTS_I_fam phosphoenolpyruvate-protein phosphotransferase. This model recognizes a distinct clade of phophoenolpyruvate (PEP)-dependent enzymes. Most members are known or deduced to function as the phosphoenolpyruvate-protein phosphotransferase (or enzyme I) of PTS sugar transport systems. However, some species with both a member of this family and a homolog of the phosphocarrier protein HPr lack a IIC component able to serve as a permease. An HPr homolog designated NPr has been implicated in the regulation of nitrogen assimilation, which demonstrates that not all phosphotransferase system components are associated directly with PTS transport.
Probab=49.40  E-value=19  Score=34.94  Aligned_cols=38  Identities=29%  Similarity=0.469  Sum_probs=29.6

Q ss_pred             hhHHHHHHHHHHHHHhCCC---------------------CCCCcc-chhhHHHHHHHHh
Q 046561          127 SLDALIGRLRAAFEENGGK---------------------PEANPF-GARAVRLYLREVR  164 (204)
Q Consensus       127 SLDALIGRLRAafEE~Gg~---------------------pE~NPF-~araVRlYLReVR  164 (204)
                      +.|...-..|.+.+..+++                     .|.||| |-|+||+||..-.
T Consensus       308 ~e~eq~~~y~~i~~~~~~~pv~iRtlDig~DK~~~~~~~~~E~NP~LG~RgiR~~l~~~~  367 (565)
T TIGR01417       308 TEEEQFAAYKTVLEAMESDAVIVRTLDIGGDKELPYLNFPKEENPFLGYRAIRLALEREE  367 (565)
T ss_pred             CHHHHHHHHHHHHHHhCCCceEEECCCCCCcccccccCCCCCCCccccchhhhhcccCHH
Confidence            4577777788888888766                     379998 8899999997533


No 21 
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional
Probab=47.51  E-value=14  Score=28.23  Aligned_cols=23  Identities=30%  Similarity=0.563  Sum_probs=17.5

Q ss_pred             hhhhcc--------hhHHHHHHHHHHHHHhC
Q 046561          121 LRQAWG--------SLDALIGRLRAAFEENG  143 (204)
Q Consensus       121 lRQAwG--------SLDALIGRLRAafEE~G  143 (204)
                      +++.||        +||.+|.|||.-+++.+
T Consensus       175 ~~~~w~~~~~~~~~~v~~~i~rLR~kl~~~~  205 (223)
T PRK10816        175 MLQLYPDAELRESHTIDVLMGRLRKKIQAQY  205 (223)
T ss_pred             HHHhcCCCCCCCcCCHHHHHHHHHHHhccCC
Confidence            556676        78999999999887643


No 22 
>COG4974 XerD Site-specific recombinase XerD [DNA replication, recombination, and repair]
Probab=46.40  E-value=21  Score=33.00  Aligned_cols=38  Identities=29%  Similarity=0.544  Sum_probs=34.0

Q ss_pred             hhhhhHHHHHHHhcCCCC-ccccCcchhHHHHHHhhcccCc
Q 046561           58 RRDWNTFGQYLKNHRPPL-SLSRCSGAHVLEFLRYLDQFGK   97 (204)
Q Consensus        58 Rrdwntf~qyL~n~rPPl-sL~~csg~hVleFLrylDqfGk   97 (204)
                      |||-+.|.+||..+-  + +|...+-.||.+||.++-.+|.
T Consensus        31 rrDL~~f~~~L~~~~--~~~l~~~~~~di~~yl~~l~~~g~   69 (300)
T COG4974          31 RRDLEDFREWLEERG--ITDLADATEADIREYLTELAEQGL   69 (300)
T ss_pred             HHHHHHHHHHHHhcC--CCChhhcCHHHHHHHHHHHHhCCc
Confidence            689999999999876  5 6888899999999999999995


No 23 
>PF06252 DUF1018:  Protein of unknown function (DUF1018);  InterPro: IPR009363 This family consists of several bacterial and phage proteins, related to Gp16 of phage Mu, of unknown function.
Probab=45.87  E-value=1.2e+02  Score=23.21  Aligned_cols=87  Identities=18%  Similarity=0.242  Sum_probs=57.1

Q ss_pred             hhhHHHHHHHhcCCCCccccCcchhHHHHHHhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHHHHHHH
Q 046561           60 DWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHPNPPAPCPCPLRQAWGSLDALIGRLRAAF  139 (204)
Q Consensus        60 dwntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfGkTkVH~~~C~ffG~p~ppapC~CPlRQAwGSLDALIGRLRAaf  139 (204)
                      |..++..+|.++..=-+...|+-....++|.++.+.|-. +....=.+-+.|..             ...+.+.+|+|..
T Consensus         2 ddd~YR~~L~~~~Gk~S~k~lt~~el~~vl~~l~~~G~k-~~~~~~~~~~~~~~-------------~~~~q~~KI~aLw   67 (119)
T PF06252_consen    2 DDDTYRALLQRVTGKSSSKDLTEAELEKVLDELKRLGFK-PPKPARRPGRRPGM-------------ATSAQLRKIRALW   67 (119)
T ss_pred             CHHHHHHHHHHHhChhhHHHCCHHHHHHHHHHHHHccCc-CccccccCCCCCCC-------------cchHHHHHHHHHH
Confidence            456788888888887788889999999999988888853 22111111111111             1788999999999


Q ss_pred             HHhCCCCC-CCccchhhHHHHHH
Q 046561          140 EENGGKPE-ANPFGARAVRLYLR  161 (204)
Q Consensus       140 EE~Gg~pE-~NPF~araVRlYLR  161 (204)
                      .++|.... .|| ...++.-|++
T Consensus        68 ~~~~~~~~v~~~-s~~aL~~fvk   89 (119)
T PF06252_consen   68 KQLGKPGAVRDP-SEAALDAFVK   89 (119)
T ss_pred             HHhhccCCccch-HHHHHHHHHH
Confidence            99997655 333 2334444443


No 24 
>cd00801 INT_P4 Bacteriophage P4 integrase. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements.  They share the same fold in their catalytic domain and the overall reaction mechanism with the superfamily of DNA breaking-rejoining enzymes. The P4 integrase mediates integrative and excisive site-specific recombination between two sites, called attachment sites, located on the phage genome and the bacterial chromosome. The phage attachment site is often found adjacent to the integrase gene, while the host attachment sites are typically situated near tRNA genes.
Probab=44.67  E-value=45  Score=27.35  Aligned_cols=26  Identities=31%  Similarity=0.373  Sum_probs=19.8

Q ss_pred             chhHHHHHHHHHHHHH---hCCCCCCCccc
Q 046561          126 GSLDALIGRLRAAFEE---NGGKPEANPFG  152 (204)
Q Consensus       126 GSLDALIGRLRAafEE---~Gg~pE~NPF~  152 (204)
                      .++...++.|+++|+-   +|.- +.|||.
T Consensus       135 ~t~~~~~~~l~~~~~~a~~~g~i-~~nP~~  163 (357)
T cd00801         135 ETARRVRQRLKQVFRYAIARGLI-EANPAA  163 (357)
T ss_pred             HHHHHHHHHHHHHHHHHHHcCCc-ccCchH
Confidence            4788999999999984   4443 389985


No 25 
>smart00259 ZnF_A20 A20-like zinc fingers. A20- (an inhibitor of cell death)-like zinc fingers. The zinc finger mediates self-association in A20. These fingers also mediate IL-1-induced NF-kappaB activation.
Probab=43.92  E-value=12  Score=23.04  Aligned_cols=16  Identities=38%  Similarity=1.038  Sum_probs=13.5

Q ss_pred             CCCCCCCCCCCCCCCC
Q 046561          103 PICPFYGHPNPPAPCP  118 (204)
Q Consensus       103 ~~C~ffG~p~ppapC~  118 (204)
                      .+|.|||.+..-..|.
T Consensus         7 ~~CgF~G~~~t~~~Cs   22 (26)
T smart00259        7 PGCGFFGNPATEGLCS   22 (26)
T ss_pred             CCCCCcCChhhcccCH
Confidence            7999999998877774


No 26 
>PF00486 Trans_reg_C:  Transcriptional regulatory protein, C terminal;  InterPro: IPR001867 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []. Some bacteria can contain up to as many as 200 two-component systems that need tight regulation to prevent unwanted cross-talk []. These pathways have been adapted to response to a wide variety of stimuli, including nutrients, cellular redox state, changes in osmolarity, quorum signals, antibiotics, and more []. Two-component systems are comprised of a sensor histidine kinase (HK) and its cognate response regulator (RR) []. The HK catalyses its own auto-phosphorylation followed by the transfer of the phosphoryl group to the receiver domain on RR; phosphorylation of the RR usually activates an attached output domain, which can then effect changes in cellular physiology, often by regulating gene expression. Some HK are bifunctional, catalysing both the phosphorylation and dephosphorylation of their cognate RR. The input stimuli can regulate either the kinase or phosphatase activity of the bifunctional HK. A variant of the two-component system is the phospho-relay system. Here a hybrid HK auto-phosphorylates and then transfers the phosphoryl group to an internal receiver domain, rather than to a separate RR protein. The phosphoryl group is then shuttled to histidine phosphotransferase (HPT) and subsequently to a terminal RR, which can evoke the desired response [, ]. This entry represents a domain that is almost always found associated with the response regulator receiver domain (see IPR001789 from INTERPRO). It may play a role in DNA binding [].; GO: 0000156 two-component response regulator activity, 0003677 DNA binding, 0000160 two-component signal transduction system (phosphorelay), 0006355 regulation of transcription, DNA-dependent; PDB: 2K4J_A 2JPB_A 1ODD_A 1OPC_A 1KGS_A 2PMU_E 2JZY_A 1GXP_B 1QQI_A 2Z33_A ....
Probab=43.38  E-value=25  Score=23.51  Aligned_cols=21  Identities=52%  Similarity=0.885  Sum_probs=18.1

Q ss_pred             chhHHHHHHHHHHHHHhCCCC
Q 046561          126 GSLDALIGRLRAAFEENGGKP  146 (204)
Q Consensus       126 GSLDALIGRLRAafEE~Gg~p  146 (204)
                      -+||.+|-|||..++..|+.+
T Consensus        44 ~~l~~~I~rLR~kL~~~~~~~   64 (77)
T PF00486_consen   44 NSLDVHISRLRKKLEDAGGDP   64 (77)
T ss_dssp             HHHHHHHHHHHHHHHSSTTSS
T ss_pred             hhHHHHHHHHHHHHhhcCCCC
Confidence            489999999999999987543


No 27 
>PF13276 HTH_21:  HTH-like domain
Probab=42.01  E-value=44  Score=22.28  Aligned_cols=29  Identities=28%  Similarity=0.447  Sum_probs=25.0

Q ss_pred             HHHHHHHHHHHHHhCCCCCCCccchhhHHHHHHH
Q 046561          129 DALIGRLRAAFEENGGKPEANPFGARAVRLYLRE  162 (204)
Q Consensus       129 DALIGRLRAafEE~Gg~pE~NPF~araVRlYLRe  162 (204)
                      |+|+-.++++|+++++     =||.+-|..+|+.
T Consensus         4 ~~l~~~I~~i~~~~~~-----~yG~rri~~~L~~   32 (60)
T PF13276_consen    4 EALRELIKEIFKESKP-----TYGYRRIWAELRR   32 (60)
T ss_pred             HHHHHHHHHHHHHcCC-----CeehhHHHHHHhc
Confidence            6789999999999977     3788888888886


No 28 
>PF14768 RPA_interact_C:  Replication protein A interacting C-terminal
Probab=39.98  E-value=27  Score=25.67  Aligned_cols=36  Identities=28%  Similarity=0.477  Sum_probs=30.6

Q ss_pred             CCCCCchhhhcc----hhHHHHHHHHHHHHHhCCCCCCCc
Q 046561          115 APCPCPLRQAWG----SLDALIGRLRAAFEENGGKPEANP  150 (204)
Q Consensus       115 apC~CPlRQAwG----SLDALIGRLRAafEE~Gg~pE~NP  150 (204)
                      --|+|-||..-+    ++|.|=-+|..+++||..+...+|
T Consensus        17 i~C~Cgl~l~~~~~~~tl~~l~~~L~~~~~~H~~~C~~~p   56 (82)
T PF14768_consen   17 ISCSCGLRLNTQQDELTLEELRQLLEEAVTEHSDRCSSTP   56 (82)
T ss_pred             EECCCccEEecCCCCCCHHHHHHHHHHHHHHHHHhCCCCC
Confidence            347777988888    999999999999999987766666


No 29 
>PRK09279 pyruvate phosphate dikinase; Provisional
Probab=39.33  E-value=27  Score=36.13  Aligned_cols=36  Identities=33%  Similarity=0.478  Sum_probs=0.0

Q ss_pred             HHHHHHHhCCC-----------CCCCcc-chhhHHHHH--HHHhhHHHhh
Q 046561          135 LRAAFEENGGK-----------PEANPF-GARAVRLYL--REVRDVQSKA  170 (204)
Q Consensus       135 LRAafEE~Gg~-----------pE~NPF-~araVRlYL--ReVRd~QAkA  170 (204)
                      ++..-++.|+.           -|.||| |.|.+|+||  .|+=++|.+|
T Consensus       636 ~~~~a~~~g~~~~k~~~~~~~~~E~NPmLG~RG~Rl~l~~pei~~~QlrA  685 (879)
T PRK09279        636 IEELAEALGLSLEELKARVEALHEFNPMLGHRGCRLGITYPEIYEMQARA  685 (879)
T ss_pred             HHHHHHHcCCCHHHHHHHhcCCCCCCCccccchhhcccCChHHHHHHHHH


No 30 
>smart00862 Trans_reg_C Transcriptional regulatory protein, C terminal. This domain is almost always found associated with the response regulator receiver domain. It may play a role in DNA binding.
Probab=38.74  E-value=33  Score=22.74  Aligned_cols=19  Identities=42%  Similarity=0.761  Sum_probs=17.1

Q ss_pred             chhHHHHHHHHHHHHHhCC
Q 046561          126 GSLDALIGRLRAAFEENGG  144 (204)
Q Consensus       126 GSLDALIGRLRAafEE~Gg  144 (204)
                      .+|+.+|-|||..+++.|+
T Consensus        45 ~~l~~~i~~LR~~l~~~~~   63 (78)
T smart00862       45 NTLDVHISRLRKKLEDDGA   63 (78)
T ss_pred             chHHHHHHHHHHHHhcCCC
Confidence            5799999999999999865


No 31 
>PRK06464 phosphoenolpyruvate synthase; Validated
Probab=37.20  E-value=42  Score=34.01  Aligned_cols=16  Identities=50%  Similarity=0.812  Sum_probs=14.1

Q ss_pred             CCCcc-chhhHHHHHHH
Q 046561          147 EANPF-GARAVRLYLRE  162 (204)
Q Consensus       147 E~NPF-~araVRlYLRe  162 (204)
                      |.||| |.|.||+||..
T Consensus       597 E~NP~LG~RGiR~~l~~  613 (795)
T PRK06464        597 EENPMLGFRGASRYLSE  613 (795)
T ss_pred             CCCCccccchhhhcccC
Confidence            78999 88999999963


No 32 
>PF11709 Mit_ribos_Mrp51:  Mitochondrial ribosomal protein subunit ;  InterPro: IPR016712 The function of mitochondrial ribosomal small-subunit protein MRP51 is not entirely clear, but deletion of the MRP51 gene completely blocks mitochondrial gene expression [].
Probab=35.05  E-value=52  Score=29.75  Aligned_cols=65  Identities=22%  Similarity=0.229  Sum_probs=47.0

Q ss_pred             CCCchHHHhhhhhhhHHHHHHHhcCCCCcc--ccCcchhHHHHHHh-----------------hcccCcccccCCCCCCC
Q 046561           48 SSSSRYENQKRRDWNTFGQYLKNHRPPLSL--SRCSGAHVLEFLRY-----------------LDQFGKTKVHTPICPFY  108 (204)
Q Consensus        48 ~~~SrYesQKRrdwntf~qyL~n~rPPlsL--~~csg~hVleFLry-----------------lDqfGkTkVH~~~C~ff  108 (204)
                      ..-.+|-++=|..-.+|.+||+.+.|-...  ..--...|.|||..                 ....|..++|..+=--|
T Consensus       146 ~ef~~yL~kvr~~R~eF~~~L~~~~~e~~~~~~~~l~~~v~eFL~~~~~~~~~~~~~~~~~~~~~~~~~~~~hpsgGLSY  225 (312)
T PF11709_consen  146 GEFERYLKKVRPLRPEFKKWLREKHPESLTFDPSDLYDLVKEFLDLAPLKPPDVPDSKKSSSPYAEAGPPKTHPSGGLSY  225 (312)
T ss_pred             HHHHHHHHHhHHHHHHHHHHHHHhChhhhccCHHHHHHHHHHHHhcccccCcccccchhccCcccccCCCccccCcCcCc
Confidence            345688888899999999999999986621  23345678899975                 33567778887776666


Q ss_pred             CCCC
Q 046561          109 GHPN  112 (204)
Q Consensus       109 G~p~  112 (204)
                      .+++
T Consensus       226 ~~~g  229 (312)
T PF11709_consen  226 NRTG  229 (312)
T ss_pred             CCCc
Confidence            6554


No 33 
>PRK11177 phosphoenolpyruvate-protein phosphotransferase; Provisional
Probab=35.04  E-value=35  Score=33.38  Aligned_cols=37  Identities=30%  Similarity=0.479  Sum_probs=29.7

Q ss_pred             hhHHHHHHHHHHHHHhCCC---------------------CCCCcc-chhhHHHHHHHH
Q 046561          127 SLDALIGRLRAAFEENGGK---------------------PEANPF-GARAVRLYLREV  163 (204)
Q Consensus       127 SLDALIGRLRAafEE~Gg~---------------------pE~NPF-~araVRlYLReV  163 (204)
                      +-|...--.|.+.+.++++                     .|.||| |-|+||+||+.-
T Consensus       309 ~eeeq~~~y~~i~~~~~~~~v~iRtlDiGgDK~~~~~~~~~E~NP~LG~RgiR~~l~~~  367 (575)
T PRK11177        309 TEEEQFQAYKAVAEAMGSQAVIVRTMDIGGDKELPYMNLPKEENPFLGWRAIRIAMDRK  367 (575)
T ss_pred             CHHHHHHHHHHHHHHcCCCeEEEECcCCCcccccccCCCCCCCCcccccchhhhcCCCH
Confidence            4677778888888888765                     379999 779999999653


No 34 
>TIGR01828 pyru_phos_dikin pyruvate, phosphate dikinase. This model represents pyruvate,phosphate dikinase, also called pyruvate,orthophosphate dikinase. It is similar in sequence to other PEP-utilizing enzymes.
Probab=34.37  E-value=22  Score=36.44  Aligned_cols=25  Identities=40%  Similarity=0.656  Sum_probs=19.3

Q ss_pred             CCCCcc-chhhHHHHH--HHHhhHHHhh
Q 046561          146 PEANPF-GARAVRLYL--REVRDVQSKA  170 (204)
Q Consensus       146 pE~NPF-~araVRlYL--ReVRd~QAkA  170 (204)
                      .|.||| |.|.||+||  .++=+.|.+|
T Consensus       652 ~E~NP~LG~RGiRl~l~~pei~~~QlrA  679 (856)
T TIGR01828       652 HEVNPMLGHRGCRLGITYPEIYEMQVRA  679 (856)
T ss_pred             CCCCCccccchhhhccCChHHHHHHHHH
Confidence            599999 889999999  4555566544


No 35 
>PF09107 SelB-wing_3:  Elongation factor SelB, winged helix ;  InterPro: IPR015191 This entry represents a domain with a winged helix-type fold, which consists of a closed 3-helical bundle with a right-handed twist, and a small beta-sheet wing []. Different winged helix domains share a common structure, but can differ in sequence. This entry is designated "type 3".  The winged helix motif is involved in both DNA and RNA binding. In the elongation factor SelB, the winged helix domains recognise RNA, allowing the complex to wrap around the small ribosomal subunit. In bacteria, the incorporation of the amino acid selenocysteine into proteins requires elongation factor SelB, which binds both transfer RNA (tRNA) and mRNA. SelB binds to an mRNA hairpin formed by the selenocysteine insertion sequence (SECIS) with extremely high specificity []. ; GO: 0003723 RNA binding, 0003746 translation elongation factor activity, 0005525 GTP binding, 0001514 selenocysteine incorporation, 0005737 cytoplasm; PDB: 2PJP_A 2UWM_A 1WSU_B 1LVA_A 2PLY_A.
Probab=34.16  E-value=23  Score=24.43  Aligned_cols=21  Identities=33%  Similarity=0.456  Sum_probs=17.3

Q ss_pred             cCcchhHHHHHHhhcccCccc
Q 046561           79 RCSGAHVLEFLRYLDQFGKTK   99 (204)
Q Consensus        79 ~csg~hVleFLrylDqfGkTk   99 (204)
                      ..|=+-++-+|.|+|+.|.|+
T Consensus        21 g~sRK~ai~lLE~lD~~g~T~   41 (50)
T PF09107_consen   21 GLSRKYAIPLLEYLDREGITR   41 (50)
T ss_dssp             TS-HHHHHHHHHHHHHTTSEE
T ss_pred             CccHHHHHHHHHHHhccCCEE
Confidence            356677899999999999997


No 36 
>PF03344 Daxx:  Daxx Family;  InterPro: IPR005012  Daxx is a ubiquitously expressed protein that functions, in part, as a transcriptional co-repressor through its interaction with a growing number of nuclear, DNA-associated proteins. Human Daxx contains four structural domains commonly found in transcriptional regulatory proteins: two predicted paired amphipathic helices, an acid-rich domain and a Ser/Pro/Thr (SPT)-rich domain. The post-translational modification status of the SPT-domain of hDaxx regulates its association with transcription factors such as Pax3 and ETS-1, effectively bringing hDaxx to sites of active transcription. Through its presence at the site of active transcription, hDaxx could then be able to associate with acetylated histones present in the nucleosomes and Dek that is associated with chromatin. Through its association with the SPT-domain of hDaxx, histone deacetylases may also be brought to the site of active transcription. As a consequence, nucleosomes in the vicinity of the site of active transcription will have the histone tails deacetylated, allowing the deactylated tail to bind to DNA, thereby leading to an inactive chromatin structure and transcriptional repression [].  The Daxx protein (also known as the Fas-binding protein) is thought to play a role in apoptosis as a component of nuclear promyelocytic leukemia protein (PML) oncogenic domains (PODS). Daxx associates with PODs through a direct interaction with PML, a critical component of PODs. The interaction is a dynamic, cell cycle regulated event and is dependent on the post-translational modification of PML by the small ubiquitin-related modifier SUMO-1. ; PDB: 2KZS_A 2KZU_A.
Probab=33.66  E-value=1.5e+02  Score=30.31  Aligned_cols=75  Identities=23%  Similarity=0.254  Sum_probs=44.5

Q ss_pred             HHHhhhhhhhHHHHHHHhcCCCCccccCcchhHHHHHHhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHH
Q 046561           53 YENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHPNPPAPCPCPLRQAWGSLDALI  132 (204)
Q Consensus        53 YesQKRrdwntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfGkTkVH~~~C~ffG~p~ppapC~CPlRQAwGSLDALI  132 (204)
                      ||+||  ++..|..+-..+.-       ....|+.||+        +.|...++              .-++.-..=-+|
T Consensus        66 ~~~~~--lf~eFi~~C~~~~~-------d~~evv~~L~--------~~~~~~~~--------------~f~~S~~F~~~l  114 (713)
T PF03344_consen   66 YENQK--LFEEFIELCLAQTS-------DMPEVVKFLK--------RRYEKAHP--------------EFLSSEEFRNFL  114 (713)
T ss_dssp             -HHHH--HHHHHHHHHHHHTT-------T-TTHHHHHH--------HHHHTC-C--------------CHHCSHHHHHHH
T ss_pred             ChHHH--HHHHHHHHhccccc-------CCHHHHHHHH--------HHHHhCCH--------------HHHhHHHHHHHH
Confidence            45553  56666666554321       2346999997        33333333              334444555677


Q ss_pred             HHHHHHHHHhCCCCCCCccchhhHHHHHHHHhhHHH
Q 046561          133 GRLRAAFEENGGKPEANPFGARAVRLYLREVRDVQS  168 (204)
Q Consensus       133 GRLRAafEE~Gg~pE~NPF~araVRlYLReVRd~QA  168 (204)
                      ++-++....+..+          |=+||.+|-+.=.
T Consensus       115 ~~~~~~~~~~~~k----------~yv~i~~v~~~lk  140 (713)
T PF03344_consen  115 SRCLARIQNNPKK----------VYVHINEVCTELK  140 (713)
T ss_dssp             HHHHHHHHH-CCC----------HHHHHHHHHHHHH
T ss_pred             HHHHHHHHCCCCe----------EEEEHHHHHHHHH
Confidence            8887777777655          8899999987643


No 37 
>PF00140 Sigma70_r1_2:  Sigma-70 factor, region 1.2;  InterPro: IPR009042 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes.  With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognised by the major sigma factors [, ]. ; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, DNA-dependent, 0006355 regulation of transcription, DNA-dependent; PDB: 1SMY_F 1IW7_P 1SIG_A 3IYD_F 2BE5_F 2A6E_F 2CW0_F 2A69_P 2A6H_P 3DXJ_P ....
Probab=33.58  E-value=32  Score=21.99  Aligned_cols=12  Identities=42%  Similarity=0.866  Sum_probs=10.1

Q ss_pred             hhHHHHHHHHhh
Q 046561          154 RAVRLYLREVRD  165 (204)
Q Consensus       154 raVRlYLReVRd  165 (204)
                      -+|++||++|+.
T Consensus         2 D~l~~Yl~ei~~   13 (37)
T PF00140_consen    2 DSLRLYLKEIGR   13 (37)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             cHHHHHHHHHcC
Confidence            478999999975


No 38 
>cd04372 RhoGAP_chimaerin RhoGAP_chimaerin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of chimaerins. Chimaerins are a family of phorbolester- and diacylglycerol-responsive GAPs specific for the Rho-like GTPase Rac. Chimaerins exist in two alternative splice forms that each contain a C-terminal GAP domain, and a central C1 domain which binds phorbol esters, inducing a conformational change that activates the protein; one splice form is lacking the N-terminal Src homology-2 (SH2) domain. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GT
Probab=33.44  E-value=47  Score=27.16  Aligned_cols=36  Identities=25%  Similarity=0.475  Sum_probs=26.4

Q ss_pred             HHHHHHHHHHHHhCCCCC---C---Cc-cchhhHHHHHHHHhh
Q 046561          130 ALIGRLRAAFEENGGKPE---A---NP-FGARAVRLYLREVRD  165 (204)
Q Consensus       130 ALIGRLRAafEE~Gg~pE---~---NP-F~araVRlYLReVRd  165 (204)
                      .-|.+|+..|++.|...+   .   ++ -.|..++.||||.-+
T Consensus        45 ~~i~~l~~~~d~~~~~~~~~~~~~~d~h~va~lLK~flReLP~   87 (194)
T cd04372          45 EEIEDVKMAFDRDGEKADISATVYPDINVITGALKLYFRDLPI   87 (194)
T ss_pred             HHHHHHHHHHcCCCCccCCcccccccHHHHHHHHHHHHHhCCC
Confidence            478889999998775432   1   22 268889999999755


No 39 
>PF08544 GHMP_kinases_C:  GHMP kinases C terminal ;  InterPro: IPR013750 This domain is found in homoserine kinases (2.7.1.39 from EC), galactokinases (2.7.1.6 from EC) and mevalonate kinases (2.7.1.36 from EC). These kinases make up the GHMP kinase superfamily of ATP-dependent enzymes []. These enzymes are involved in the biosynthesis of isoprenes and amino acids as well as in carbohydrate metabolism. The C-terminal domain of homoserine kinase has a central alpha-beta plait fold and an insertion of four helices, which, together with the N-terminal fold, create a novel nucleotide binding fold [].; PDB: 2R3V_C 4EMD_A 4DXL_A 4ED4_A 2GS8_A 1K47_E 3GON_A 3K17_B 1PIE_A 2AJ4_A ....
Probab=31.63  E-value=7.5  Score=26.40  Aligned_cols=72  Identities=14%  Similarity=0.214  Sum_probs=45.3

Q ss_pred             hhhhhhHHHHHHHhcCC--CCccccCcchhHHHHHHhhcccC--cccccC---CCCCCCCCCCCCCCCCCchhhhcchhH
Q 046561           57 KRRDWNTFGQYLKNHRP--PLSLSRCSGAHVLEFLRYLDQFG--KTKVHT---PICPFYGHPNPPAPCPCPLRQAWGSLD  129 (204)
Q Consensus        57 KRrdwntf~qyL~n~rP--PlsL~~csg~hVleFLrylDqfG--kTkVH~---~~C~ffG~p~ppapC~CPlRQAwGSLD  129 (204)
                      ++.||..|.+.+.+..-  +.....+...+|.+.+.++-+.|  -+++-.   -+|.|-            |=.--...|
T Consensus         6 ~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~Ga~~~~~sGsG~G~~v~~------------l~~~~~~~~   73 (85)
T PF08544_consen    6 AEGDLELLGELMNENQENEPENYREVLTPEIDELKEAAEENGALGAKMSGSGGGPTVFA------------LCKDEDDAE   73 (85)
T ss_dssp             HTTCHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHTTESEEEEETTSSSSEEEE------------EESSHHHHH
T ss_pred             HCcCHHHHHHHHHHhhhhcchHHHHHcCHHHHHHHHHHHHCCCCceecCCCCCCCeEEE------------EECCHHHHH
Confidence            46899999999995544  44456677788888888888888  333311   333221            212223566


Q ss_pred             HHHHHHHHHHH
Q 046561          130 ALIGRLRAAFE  140 (204)
Q Consensus       130 ALIGRLRAafE  140 (204)
                      .++-+|++.|+
T Consensus        74 ~v~~~l~~~~~   84 (85)
T PF08544_consen   74 RVAEALREHYK   84 (85)
T ss_dssp             HHHHHHHHHTH
T ss_pred             HHHHHHHHhCC
Confidence            77777777664


No 40 
>PF09336 Vps4_C:  Vps4 C terminal oligomerisation domain;  InterPro: IPR015415 This domain is found at the C-terminal of ATPase proteins involved in vacuolar sorting. It forms an alpha helix structure and is required for oligomerisation []. ; PDB: 1XWI_A 3EIH_C 2QPA_C 3EIE_A 2RKO_A 2QP9_X 3MHV_C 3CF3_C 3CF1_A 3CF2_A ....
Probab=31.39  E-value=44  Score=23.65  Aligned_cols=31  Identities=23%  Similarity=0.490  Sum_probs=24.4

Q ss_pred             hhHHHHHHHhcCCCCccccCcchhHHHHHHhhcccC
Q 046561           61 WNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFG   96 (204)
Q Consensus        61 wntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfG   96 (204)
                      -+.|.+=|++-+|     +.+.+||..|..|-.+||
T Consensus        32 ~~DF~~Al~~~kp-----SVs~~dl~~ye~w~~~FG   62 (62)
T PF09336_consen   32 MEDFEEALKKVKP-----SVSQEDLKKYEEWTKEFG   62 (62)
T ss_dssp             HHHHHHHHHTCGG-----SS-HHHHHHHHHHHHHTS
T ss_pred             HHHHHHHHHHcCC-----CCCHHHHHHHHHHHHHcC
Confidence            3557777777777     456899999999999998


No 41 
>smart00243 GAS2 Growth-Arrest-Specific Protein 2 Domain. GROWTH-ARREST-SPECIFIC PROTEIN 2 Domain
Probab=31.28  E-value=32  Score=26.26  Aligned_cols=14  Identities=43%  Similarity=1.077  Sum_probs=13.1

Q ss_pred             hhhHHHHHHHhcCC
Q 046561           60 DWNTFGQYLKNHRP   73 (204)
Q Consensus        60 dwntf~qyL~n~rP   73 (204)
                      -|.||.+||..|.|
T Consensus        55 GW~tL~~fL~khDP   68 (73)
T smart00243       55 GWETLDEYLLKHDP   68 (73)
T ss_pred             cHHHHHHHHHhCCC
Confidence            39999999999998


No 42 
>PF03732 Retrotrans_gag:  Retrotransposon gag protein ;  InterPro: IPR005162 Transposable elements (TEs) promote various chromosomal rearrangements more efficiently, and often more specifically, than other cellular processes. Retrotransposons are structurally similar to retroviruses and are bounded by long terminal repeats. This entry represents eukaryotic Gag or capsid-related retrotranspon-related proteins. There is a central motif QGXXEXXXXXFXXLXXH that is common to Retroviridae gag-proteins, but is poorly conserved.
Probab=31.13  E-value=1.3e+02  Score=20.24  Aligned_cols=38  Identities=24%  Similarity=0.297  Sum_probs=27.7

Q ss_pred             hhhhcchhHHHHHHHHHHHHHhCC-CCCCCccchhhHHHHHHHH
Q 046561          121 LRQAWGSLDALIGRLRAAFEENGG-KPEANPFGARAVRLYLREV  163 (204)
Q Consensus       121 lRQAwGSLDALIGRLRAafEE~Gg-~pE~NPF~araVRlYLReV  163 (204)
                      ++|.-+||+..+-|++......+. -+|     .-.|..|++-+
T Consensus        56 l~Q~~esv~~y~~rf~~l~~~~~~~~~e-----~~~v~~f~~GL   94 (96)
T PF03732_consen   56 LRQGNESVREYVNRFRELARRAPPPMDE-----EMLVERFIRGL   94 (96)
T ss_pred             hhccCCcHHHHHHHHHHHHHHCCCCcCH-----HHHHHHHHHCC
Confidence            778777999999999999999885 222     44555555433


No 43 
>cd08793 Death_IRAK4 Death domain of Interleukin-1 Receptor-Associated Kinase 4. Death Domain (DD) of Interleukin-1 Receptor-Associated Kinase 4 (IRAK4). IRAKs are essential components of innate immunity and inflammation in mammals and other vertebrates. They are involved in signal transduction pathways involving IL-1 and IL-18 receptors, Toll-like receptors, nuclear factor-kappaB, and mitogen-activated protein kinases. IRAKs contain an N-terminal DD domain and a C-terminal kinase domain. IRAK4 is an active kinase that is also involved in T-cell receptor signaling pathways, implying that it may function in acquired immunity and not just in innate immunity. It is known as the master IRAK member because its absence strongly impairs TLR- and IL-1-mediated signaling and innate immune defenses, while the absence of other IRAK proteins only shows slight effects. IRAK4-deficient patients have impaired inflammatory responses and recurrent life-threatening infections. DDs are protein-protein int
Probab=30.45  E-value=58  Score=25.80  Aligned_cols=63  Identities=27%  Similarity=0.515  Sum_probs=43.4

Q ss_pred             hhhHHHHHHHhcCCCCccccCcchhHHHHHHhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHHHHHHH
Q 046561           60 DWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHPNPPAPCPCPLRQAWGSLDALIGRLRAAF  139 (204)
Q Consensus        60 dwntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfGkTkVH~~~C~ffG~p~ppapC~CPlRQAwGSLDALIGRLRAaf  139 (204)
                      +|.++-.++..   |-.-.+.+-.||-+|=++.++              | .+|    +|-|=..||+-++-||.|-..|
T Consensus        23 ~W~~LA~~i~~---~~~~~~y~~~ei~~ie~~~~~--------------g-~SP----T~~LL~dWgt~N~TV~~L~~lL   80 (100)
T cd08793          23 GWKKIAVAIKK---PSGDPRYSQFHIRRFEALVQQ--------------G-KSP----TCELLFDWGTTNCTVGDLVDLL   80 (100)
T ss_pred             cHHHHHHHHhc---ccCCCCCCHHHHHHHHHHHHc--------------C-CCh----HHHHHHHHccCCCcHHHHHHHH
Confidence            78888877754   223334544566666554443              2 222    4557789999999999999999


Q ss_pred             HHhCC
Q 046561          140 EENGG  144 (204)
Q Consensus       140 EE~Gg  144 (204)
                      .++|-
T Consensus        81 ~k~~l   85 (100)
T cd08793          81 IQNEF   85 (100)
T ss_pred             HHccc
Confidence            99884


No 44 
>cd04396 RhoGAP_fSAC7_BAG7 RhoGAP_fSAC7_BAG7: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal SAC7 and BAG7-like proteins. Both proteins are GTPase activating proteins of Rho1, but differ functionally in vivo: SAC7, but not BAG7, is involved in the control of Rho1-mediated activation of the PKC-MPK1 pathway. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=30.21  E-value=1.8e+02  Score=24.58  Aligned_cols=37  Identities=19%  Similarity=0.300  Sum_probs=25.8

Q ss_pred             HHHHHHHHHHHHHhC---CCCCCCcc----chhhHHHHHHHHhh
Q 046561          129 DALIGRLRAAFEENG---GKPEANPF----GARAVRLYLREVRD  165 (204)
Q Consensus       129 DALIGRLRAafEE~G---g~pE~NPF----~araVRlYLReVRd  165 (204)
                      -+-|.+|+.+|++..   ...+-+.+    .+..++.|||+.-+
T Consensus        60 ~~~i~~L~~~~d~~~~~~~~~~~~~~~vh~va~lLK~fLReLPe  103 (225)
T cd04396          60 SKRIRELQLIFSTPPDYGKSFDWDGYTVHDAASVLRRYLNNLPE  103 (225)
T ss_pred             HHHHHHHHHHHccCcccCCcCCccCCCHHHHHHHHHHHHHhCCC
Confidence            357889999998753   22222333    68899999999754


No 45 
>PRK05084 xerS site-specific tyrosine recombinase XerS; Reviewed
Probab=30.05  E-value=1.1e+02  Score=25.94  Aligned_cols=68  Identities=16%  Similarity=0.245  Sum_probs=43.6

Q ss_pred             hhhhhHHHHHHHhcCC-----CC-----ccccCcchhHHHHHHhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcch
Q 046561           58 RRDWNTFGQYLKNHRP-----PL-----SLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHPNPPAPCPCPLRQAWGS  127 (204)
Q Consensus        58 Rrdwntf~qyL~n~rP-----Pl-----sL~~csg~hVleFLrylDqfGkTkVH~~~C~ffG~p~ppapC~CPlRQAwGS  127 (204)
                      +++...|.+||..+..     ..     .|...+..||.+|+.|+.+.-..      +   ++.+       +...+..+
T Consensus        42 ~~~l~~f~~~l~~~~~~~~~~~~~~~~~~l~~lt~~~i~~f~~~l~~~~~~------~---~~~~-------~~~~s~~T  105 (357)
T PRK05084         42 LTEYRRFFNWLISEGLSDASKIKDIPLSTLENLTKKDVEAFILYLRERPLL------N---GHST-------KKGNSQTT  105 (357)
T ss_pred             HHHHHHHHHHHHHcCCCCcCCcccCCHHHHHhhhHHHHHHHHHHHHhcccc------c---cccc-------ccchhHHH
Confidence            4566778888876532     11     24567899999999998642110      0   0100       01246688


Q ss_pred             hHHHHHHHHHHHHH
Q 046561          128 LDALIGRLRAAFEE  141 (204)
Q Consensus       128 LDALIGRLRAafEE  141 (204)
                      +...++-||++|.-
T Consensus       106 i~~~l~~l~~~~~~  119 (357)
T PRK05084        106 INRTLSALKSLFKY  119 (357)
T ss_pred             HHHHHHHHHHHHHH
Confidence            99999999999984


No 46 
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional
Probab=29.13  E-value=44  Score=26.02  Aligned_cols=16  Identities=44%  Similarity=0.632  Sum_probs=11.3

Q ss_pred             hhHHHHHHHHHHHHHh
Q 046561          127 SLDALIGRLRAAFEEN  142 (204)
Q Consensus       127 SLDALIGRLRAafEE~  142 (204)
                      +||..|.|||.-+++.
T Consensus       201 ~i~~~i~rlR~kl~~~  216 (240)
T PRK10701        201 SVDVAISRLRKKLLDN  216 (240)
T ss_pred             CHHHHHHHHHHhcccC
Confidence            5777777777777643


No 47 
>PF04221 RelB:  RelB antitoxin;  InterPro: IPR007337  Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. Several toxin/antitoxin pairs may occur in a single species. RelE and RelB form a toxin-antitoxin system; RelE represses translation, probably through binding ribosomes [, ]. RelB stably binds RelE, presumably deactivating it.; PDB: 2KC8_B 2K29_A.
Probab=28.75  E-value=1.2e+02  Score=21.92  Aligned_cols=39  Identities=26%  Similarity=0.445  Sum_probs=25.5

Q ss_pred             HHHHHHHHHHHHhCCCCCCCccchhhHHHHHHHHhhHHHhhhccchhhh
Q 046561          130 ALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDVQSKARGISYEKK  178 (204)
Q Consensus       130 ALIGRLRAafEE~Gg~pE~NPF~araVRlYLReVRd~QAkARgi~y~kk  178 (204)
                      .|--+..++|+++|-.+      .-||++||+.|=    +.+|||++-+
T Consensus        11 ~lK~~a~~il~~~Glt~------s~ai~~fl~qiv----~~~~iPF~~~   49 (83)
T PF04221_consen   11 ELKEEAEAILEELGLTL------SDAINMFLKQIV----REGGIPFELS   49 (83)
T ss_dssp             HHHHHHHHHHHHTT--H------HHHHHHHHHHHH----HHSS-S----
T ss_pred             HHHHHHHHHHHHcCCCH------HHHHHHHHHHHH----HhCCCCcccc
Confidence            45667788999999874      579999999874    4578998753


No 48 
>cd04400 RhoGAP_fBEM3 RhoGAP_fBEM3: RhoGAP (GTPase-activator [GAP] protein for Rho-like small GTPases) domain of fungal BEM3-like proteins. Bem3 is a GAP protein of Cdc42, and is specifically involved in the control of the initial assembly of the septin ring in yeast bud formation. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=27.80  E-value=1.2e+02  Score=24.64  Aligned_cols=39  Identities=28%  Similarity=0.393  Sum_probs=26.6

Q ss_pred             chhHHHHHHHHHHHHHhCC---C--C-CCC-ccchhhHHHHHHHHhh
Q 046561          126 GSLDALIGRLRAAFEENGG---K--P-EAN-PFGARAVRLYLREVRD  165 (204)
Q Consensus       126 GSLDALIGRLRAafEE~Gg---~--p-E~N-PF~araVRlYLReVRd  165 (204)
                      |+. ..|-+|+..|+..+.   .  + +.| .-.|..+|.||||.-+
T Consensus        49 G~~-~~i~~l~~~~~~~~~~~~~~~~~~~d~h~va~lLK~flreLP~   94 (190)
T cd04400          49 GSA-SVIKQLKERFNTEYDVDLFSSSLYPDVHTVAGLLKLYLRELPT   94 (190)
T ss_pred             CcH-HHHHHHHHHHcCCCCCCccccccccCHHHHHHHHHHHHHhCCc
Confidence            444 367999999987542   1  1 123 3468999999999854


No 49 
>PF07700 HNOB:  Heme NO binding;  InterPro: IPR011644 This ligand-binding domain is found in soluble guanylate cyclases. In soluble guanylate cyclases this domain binds heme via a covalent linkage to histidine []. Soluble guanylate cyclases are nitric oxide-responsive signaling proteins.; GO: 0020037 heme binding; PDB: 3TFE_A 2O0C_B 3TFA_A 2O09_B 2O0G_B 3L6J_A 3TFG_B 3TF8_A 3TFF_A 3TF9_B ....
Probab=27.64  E-value=25  Score=28.14  Aligned_cols=36  Identities=28%  Similarity=0.454  Sum_probs=29.3

Q ss_pred             hhhhHHHHHHHh---cCCCCccccCcchhHHHHHHhhcc
Q 046561           59 RDWNTFGQYLKN---HRPPLSLSRCSGAHVLEFLRYLDQ   94 (204)
Q Consensus        59 rdwntf~qyL~n---~rPPlsL~~csg~hVleFLrylDq   94 (204)
                      ..|..|++|+-.   ..-|-.+.++.+.++.+||.-+|.
T Consensus        65 ~~l~~fG~~~~~~~~~~~~~~~l~~~g~~~~~FL~~ld~  103 (171)
T PF07700_consen   65 ELLEEFGEYFFDFLSESGYERLLRFLGRDLFDFLNNLDN  103 (171)
T ss_dssp             HHHHHHHHHHHHHHHHHCCHHHHHCTCSSHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHhCcHHHHHhcCCCHHHHHHhHHH
Confidence            468889988876   445777789999999999998875


No 50 
>PTZ00398 phosphoenolpyruvate carboxylase; Provisional
Probab=27.60  E-value=98  Score=32.57  Aligned_cols=42  Identities=21%  Similarity=0.411  Sum_probs=31.6

Q ss_pred             cchhHHHHHHHHHHHHHhCC------------------CCCCCccc-------------hhhHHHHHHHHhhH
Q 046561          125 WGSLDALIGRLRAAFEENGG------------------KPEANPFG-------------ARAVRLYLREVRDV  166 (204)
Q Consensus       125 wGSLDALIGRLRAafEE~Gg------------------~pE~NPF~-------------araVRlYLReVRd~  166 (204)
                      |-.+=.|..+|+.+++++|+                  .=++|||.             ..|+++|+++|++.
T Consensus       264 ~~aiP~~~~~l~~al~~~~~~~~~~~~~~i~fGSWiGGDRDGNP~VTaevT~~~l~~~r~~al~~Y~~~l~~L  336 (974)
T PTZ00398        264 FDALPNFIRYIDNVLYEYNLDPLPPTKKLFTFSSWVGGDRDGNPFVTAEVTRQVVYFNRIRACELFIHMIEKL  336 (974)
T ss_pred             HHHHHHHHHHHHHHHHHhcCCCCCCCCCceeccCCCCCCCCCCCcCcHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            45566788899999988754                  23499996             35778999998865


No 51 
>cd00383 trans_reg_C Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and a response regulator. The former autophosphorylates in a histidine residue on detecting an external stimulus. The phosphate is then transferred to an invariant aspartate residue in a highly conserved receiver domain of the response regulator. Phosphorylation activates a variable effector domain of the response regulator, which triggers the cellular response. The C-terminal effector domain contains DNA and RNA polymerase binding sites. Several dimers or monomers bind head to tail to small tandem repeats upstream of the genes. The RNA polymerase binding sites interact with the alpha or sigma subunite of RNA polymerase.
Probab=27.43  E-value=54  Score=22.53  Aligned_cols=20  Identities=30%  Similarity=0.539  Sum_probs=17.2

Q ss_pred             chhHHHHHHHHHHHHHhCCC
Q 046561          126 GSLDALIGRLRAAFEENGGK  145 (204)
Q Consensus       126 GSLDALIGRLRAafEE~Gg~  145 (204)
                      .+|+.+|=|||..+.+.|+.
T Consensus        62 ~~l~~~I~rLRkkl~~~~~~   81 (95)
T cd00383          62 RTVDVHISRLRKKLEDDPSN   81 (95)
T ss_pred             ccHHHHHHHHHHHhccCCCC
Confidence            57999999999999987653


No 52 
>PF09958 DUF2192:  Uncharacterized protein conserved in archaea (DUF2192);  InterPro: IPR018693 This family of various hypothetical archaeal proteins has no known function.
Probab=26.84  E-value=55  Score=29.41  Aligned_cols=21  Identities=38%  Similarity=0.588  Sum_probs=18.3

Q ss_pred             hhHHHHHHHHHHHHHhCCCCC
Q 046561          127 SLDALIGRLRAAFEENGGKPE  147 (204)
Q Consensus       127 SLDALIGRLRAafEE~Gg~pE  147 (204)
                      +=+.||.-||..|+++|..|=
T Consensus        27 ~R~~lv~~L~~~Y~~~gIeP~   47 (231)
T PF09958_consen   27 DREELVELLREVYEENGIEPF   47 (231)
T ss_pred             CHHHHHHHHHHHHHHcCCCcC
Confidence            558999999999999998753


No 53 
>cd01355 AcnX Putative Aconitase X catalytic domain. Putative Aconitase X catalytic domain. It is predicted by comparative genomic analysis. The proteins are mainly found in archaea and proteobacteria. They are distantly related to Aconitase family of proteins by sequence similarity and seconary structure prediction. The functions have not yet been experimentally characterized. Thus, the prediction should be treated with caution.
Probab=26.74  E-value=68  Score=30.43  Aligned_cols=54  Identities=37%  Similarity=0.530  Sum_probs=35.1

Q ss_pred             chhHHHHHHhhcccC-cccccCCCCCCCCCCCCCCCCCCchhhhcchh--HH----HHHHHHHHHHHhCCCCC
Q 046561           82 GAHVLEFLRYLDQFG-KTKVHTPICPFYGHPNPPAPCPCPLRQAWGSL--DA----LIGRLRAAFEENGGKPE  147 (204)
Q Consensus        82 g~hVleFLrylDqfG-kTkVH~~~C~ffG~p~ppapC~CPlRQAwGSL--DA----LIGRLRAafEE~Gg~pE  147 (204)
                      |.-=++||..|.+.| |-+|++          .-.|-.+.++  |..+  |.    .--||..||+++|..|.
T Consensus        48 G~agl~f~e~l~~~gakv~VpT----------TlNp~~~D~~--w~~~gvd~~f~~~q~~i~~ay~~mG~~~t  108 (389)
T cd01355          48 GDAGLEFLERLADQGAKVAVPT----------TLNPISMDLH--WRELGVDEEFAEKQARLVKAYKAMGVDPT  108 (389)
T ss_pred             chhhHHHHHHHHhCCCeEeecC----------ccCCcccCcc--hhhcCCCHHHHHHHHHHHHHHHHcCCccc
Confidence            344579999886666 344432          3455666676  8755  32    34477899999998765


No 54 
>TIGR03190 benz_CoA_bzdN benzoyl-CoA reductase, bzd-type, N subunit. Members of this family are the N subunit of one of two related types of four-subunit ATP-dependent benzoyl-CoA reductase. This enzyme system catalyzes the dearomatization of benzoyl-CoA, a common intermediate in pathways for the degradation for a number of different aromatic compounds, such as phenol and toluene.
Probab=26.71  E-value=4.9e+02  Score=23.65  Aligned_cols=24  Identities=21%  Similarity=0.308  Sum_probs=20.6

Q ss_pred             HHHhhhhhhhHHHHHHHhcCCCCc
Q 046561           53 YENQKRRDWNTFGQYLKNHRPPLS   76 (204)
Q Consensus        53 YesQKRrdwntf~qyL~n~rPPls   76 (204)
                      ..++.|+.|+.|.++.+.+.+|++
T Consensus       166 ~~n~~r~~~~~~~~l~~~~p~pit  189 (377)
T TIGR03190       166 VCDENRRLLRELFDYRKEADPKVT  189 (377)
T ss_pred             HHHHHHHHHHHHHHHHccCCCCcC
Confidence            456789999999999988888887


No 55 
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]
Probab=26.65  E-value=52  Score=27.97  Aligned_cols=28  Identities=36%  Similarity=0.662  Sum_probs=22.2

Q ss_pred             Cchhhhcc--------hhHHHHHHHHHHHHHhCCCC
Q 046561          119 CPLRQAWG--------SLDALIGRLRAAFEENGGKP  146 (204)
Q Consensus       119 CPlRQAwG--------SLDALIGRLRAafEE~Gg~p  146 (204)
                      --+.+.||        +||..|+|||.-+++.++.+
T Consensus       177 ~L~~~vw~~~~~~~~rtvdvhI~rLR~Kl~~~~~~~  212 (229)
T COG0745         177 QLLEAVWGYDFEVDSRTVDVHISRLRKKLEKDPGAG  212 (229)
T ss_pred             HHHHHhcCCCCCCCccCHHHHHHHHHHHhccCCCCC
Confidence            34677787        49999999999999886543


No 56 
>PRK11235 bifunctional antitoxin/transcriptional repressor RelB; Provisional
Probab=26.09  E-value=1.3e+02  Score=22.65  Aligned_cols=38  Identities=29%  Similarity=0.454  Sum_probs=28.2

Q ss_pred             HHHHHHHHHHHHhCCCCCCCccchhhHHHHHHHHhhHHHhhhccchhh
Q 046561          130 ALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDVQSKARGISYEK  177 (204)
Q Consensus       130 ALIGRLRAafEE~Gg~pE~NPF~araVRlYLReVRd~QAkARgi~y~k  177 (204)
                      .|--+.-++|++.|-.+      ..|||+||+.|    ++.+|||++.
T Consensus        11 ~lK~~A~~vl~~lGls~------S~Ai~~fl~qi----~~~~~iPF~~   48 (80)
T PRK11235         11 ELKARAYAVLEKLGVTP------SEALRLLLQYV----AENGRLPFKT   48 (80)
T ss_pred             HHHHHHHHHHHHhCCCH------HHHHHHHHHHH----HHhCCCCCCC
Confidence            44556678899999874      57999999887    4457787763


No 57 
>TIGR02249 integrase_gron integron integrase. Members of this family are integrases associated with integrons (and super-integrons), which are systems for incorporating and expressing cassettes of laterally transferred DNA. Incorporation occurs at an attI site. A super-integron, as in Vibrio sp., may include over 100 cassettes. This family belongs to the phage integrase family (pfam00589) that also includes recombinases XerC (TIGR02224) and XerD (TIGR02225), which are bacterial housekeeping proteins. Within this family of integron integrases, some are designated by class, e.g. IntI4, a class 4 integron integrase from Vibrio cholerae N16961.
Probab=26.03  E-value=1.8e+02  Score=24.04  Aligned_cols=33  Identities=18%  Similarity=0.098  Sum_probs=24.4

Q ss_pred             hhhhhHHHHHHHhcCCCCccccCcchhHHHHHHhhcc
Q 046561           58 RRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQ   94 (204)
Q Consensus        58 Rrdwntf~qyL~n~rPPlsL~~csg~hVleFLrylDq   94 (204)
                      ...++.|.+|+.+    +.+..-+..||.+||.++-+
T Consensus        23 ~~~~~~~~~~~g~----~~~~~it~~~i~~~l~~l~~   55 (315)
T TIGR02249        23 LHWIKRFIRFHNK----RHPSTMGDTEVEAFLSDLAV   55 (315)
T ss_pred             HHHHHHHHHHhCC----CChHhcCHHHHHHHHHHHHh
Confidence            4578888888642    34556689999999999854


No 58 
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms]
Probab=26.02  E-value=37  Score=32.78  Aligned_cols=31  Identities=35%  Similarity=0.511  Sum_probs=23.0

Q ss_pred             HHHHHHHHhCCC--------CCCCccchhhHHHHHHHHhh
Q 046561          134 RLRAAFEENGGK--------PEANPFGARAVRLYLREVRD  165 (204)
Q Consensus       134 RLRAafEE~Gg~--------pE~NPF~araVRlYLReVRd  165 (204)
                      -||++||-||+.        |+.|=. +..++.||||+=|
T Consensus       233 mLR~~fe~n~r~~el~~E~iPD~nvI-tg~~kD~lrElpE  271 (442)
T KOG1452|consen  233 MLRRDFEPNGRDFELGAESIPDYNVI-TGDSKDELRELPE  271 (442)
T ss_pred             HHHHHhccCCcccccccccCCCccee-ecccHhHHHhCCC
Confidence            589999999975        334433 4589999999743


No 59 
>cd04436 DEP_fRgd2 DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in fungal RhoGAP (GTPase-activator protein) Rgd2-like proteins. Rgd2-like proteins share a common domain architecture, containing, beside the RhoGAP domain, a DEP and a FCH (Fes/CIP4 homology) domain. Yeast Rgd2 is a GAP protein for Cdc42 and Rho5.
Probab=25.98  E-value=50  Score=25.54  Aligned_cols=40  Identities=28%  Similarity=0.458  Sum_probs=30.0

Q ss_pred             hHHHHHHHhcCCCCccccC--cchhHH--HHHHhhcccCccccc
Q 046561           62 NTFGQYLKNHRPPLSLSRC--SGAHVL--EFLRYLDQFGKTKVH  101 (204)
Q Consensus        62 ntf~qyL~n~rPPlsL~~c--sg~hVl--eFLrylDqfGkTkVH  101 (204)
                      .++++||..++|=.++..|  -|.|++  .|||+.+..|.|-++
T Consensus        33 ~~Iv~~L~~n~~~~s~~~aE~fGQdLv~~gfir~~g~vG~~F~n   76 (84)
T cd04436          33 SEIVSWLQENMPEKDLDAAEAFGQDLLNQGFLRLVGGVGSTFVN   76 (84)
T ss_pred             HHHHHHHHHcCCCCCHHHHHHHHHHHHhCchHHHhcccCcceec
Confidence            4688899888887666644  366775  499999999987665


No 60 
>cd01187 INT_SG4 INT_SG4, DNA breaking-rejoining enzymes, integrase/recombinases subgroup 4, N- and C-terminal domains. The CD contains mainly predicted bacterial integrase/recombinases for which not much biochemical characterization is available.
Probab=25.62  E-value=2.9e+02  Score=22.49  Aligned_cols=29  Identities=14%  Similarity=0.135  Sum_probs=20.7

Q ss_pred             hhhHHHHHHHhcCCCCccccCcchhHHHHHHhh
Q 046561           60 DWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYL   92 (204)
Q Consensus        60 dwntf~qyL~n~rPPlsL~~csg~hVleFLryl   92 (204)
                      .-+.|.+|+.++.    +...+..||.+|+.++
T Consensus        25 ~~~~f~~~~~~~~----~~~it~~~~~~~~~~~   53 (299)
T cd01187          25 LLRDFVRFLERHG----AGFITTDLALRWAASP   53 (299)
T ss_pred             HHHHHHHHHHhCC----CCCCCHHHHHHHHhcC
Confidence            3456888887654    5677888888888653


No 61 
>cd04388 RhoGAP_p85 RhoGAP_p85: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in the p85 isoforms of the regulatory subunit of the class IA PI3K (phosphatidylinositol 3'-kinase). This domain is also called Bcr (breakpoint cluster region protein) homology (BH) domain. Class IA PI3Ks are heterodimers, containing a regulatory subunit (p85) and a catalytic subunit (p110) and are activated by growth factor receptor tyrosine kinases (RTKs); this activation is mediated by the p85 subunit. p85 isoforms, alpha and beta, contain a C-terminal p110-binding domain flanked by two SH2 domains, an N-terminal SH3 domain, and a RhoGAP domain flanked by two proline-rich regions. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell p
Probab=25.17  E-value=74  Score=27.17  Aligned_cols=34  Identities=18%  Similarity=0.289  Sum_probs=24.3

Q ss_pred             HHHHHHHHHHhCCCCC---CCcc-chhhHHHHHHHHhh
Q 046561          132 IGRLRAAFEENGGKPE---ANPF-GARAVRLYLREVRD  165 (204)
Q Consensus       132 IGRLRAafEE~Gg~pE---~NPF-~araVRlYLReVRd  165 (204)
                      +-.||.+||+.+...+   .++. .+.+++.|||+.-|
T Consensus        45 ~~~lk~~~d~~~~~~d~~~~dv~~va~~LK~ylReLPe   82 (200)
T cd04388          45 LTELRQILDCDAASVDLEQFDVAALADALKRYLLDLPN   82 (200)
T ss_pred             HHHHHHHHhcCCCCCCcccccHHHHHHHHHHHHHhCCC
Confidence            4568999998655443   2232 78999999999765


No 62 
>PF09674 DUF2400:  Protein of unknown function (DUF2400);  InterPro: IPR014127 Members of this uncharacterised protein family are found sporadically, so far only among spirochetes, epsilon and delta proteobacteria, and Bacteroides. The function is unknown and its gene neighbourhoods show little conservation.
Probab=25.13  E-value=63  Score=28.46  Aligned_cols=52  Identities=13%  Similarity=0.257  Sum_probs=36.4

Q ss_pred             hhhcchhHHHHHHHHHHHHHhCCCCC--------------CCccc-----hhhHHHHHHHHhhHHHhhhcc
Q 046561          122 RQAWGSLDALIGRLRAAFEENGGKPE--------------ANPFG-----ARAVRLYLREVRDVQSKARGI  173 (204)
Q Consensus       122 RQAwGSLDALIGRLRAafEE~Gg~pE--------------~NPF~-----araVRlYLReVRd~QAkARgi  173 (204)
                      -.|||.+..+|-.|..+|+.+|..|-              -+-|-     ..-+..+|..++..-.+.-++
T Consensus        24 ~lAyG~~~~I~~~~~~ll~~~~~~P~~~v~~~~~~~~~~~~~~~~yRf~~~~D~~~~~~~l~~i~~~~gsL   94 (232)
T PF09674_consen   24 LLAYGNRKQIIKKLERLLDLMGPSPYDFVLSGDEKDDRKDLEGFFYRFQNGEDMYAFFIALKRIYQEYGSL   94 (232)
T ss_pred             HHHccCHHHHHHHHHHHHHHhCCCHHHHHHcCCHhhhHHHccCCCcCCCCHHHHHHHHHHHHHHHHccCCH
Confidence            36999999999999999999999862              23332     334556666666655544444


No 63 
>PF10780 MRP_L53:  39S ribosomal protein L53/MRP-L53;  InterPro: IPR019716 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ].  Mitochondrial ribosomal protein L53 (also known as L44) is part of the 39S ribosome []. 
Probab=24.97  E-value=37  Score=23.58  Aligned_cols=25  Identities=44%  Similarity=0.786  Sum_probs=17.7

Q ss_pred             Cccc--hhhHHHHHHHHhhHHHhhhccc
Q 046561          149 NPFG--ARAVRLYLREVRDVQSKARGIS  174 (204)
Q Consensus       149 NPF~--araVRlYLReVRd~QAkARgi~  174 (204)
                      |||.  ++..|++|.-+ ..-+|++|+.
T Consensus         2 nPF~~~aksaR~FL~~i-p~s~k~~~tn   28 (51)
T PF10780_consen    2 NPFSPNAKSARLFLSLI-PPSAKARGTN   28 (51)
T ss_pred             CCCCcccHHHHHHHHhc-CCccccccCC
Confidence            7884  67799999988 4445555543


No 64 
>PF00179 UQ_con:  Ubiquitin-conjugating enzyme;  InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ]. Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade []. The E1 enzyme mediates an ATP-dependent transfer of a thioester-linked ubiquitin molecule to a cysteine residue on the E2 enzyme. The E2 enzyme (6.3.2.19 from EC) then either transfers the ubiquitin moiety directly to a substrate, or to an E3 ligase, which can also ubiquitinylate a substrate. There are several different E2 enzymes (over 30 in humans), which are broadly grouped into four classes, all of which have a core catalytic domain (containing the active site cysteine), and some of which have short N- and C-terminal amino acid extensions: class I enzymes consist of just the catalytic core domain (UBC), class II possess a UBC and a C-terminal extension, class III possess a UBC and an N-terminal extension, and class IV possess a UBC and both N- and C-terminal extensions. These extensions appear to be important for some subfamily function, including E2 localisation and protein-protein interactions []. In addition, there are proteins with an E2-like fold that are devoid of catalytic activity, but which appear to assist in poly-ubiquitin chain formation.; GO: 0016881 acid-amino acid ligase activity; PDB: 2AAK_A 3SY2_C 1FBV_C 3SQV_C 1C4Z_D 1JAT_B 2GMI_B 2H2Y_D 2R0J_A 3E95_B ....
Probab=24.96  E-value=1.7e+02  Score=22.37  Aligned_cols=45  Identities=20%  Similarity=0.549  Sum_probs=36.1

Q ss_pred             hcc---hhHHHHHHHHHHHHHhCCCCCCCccchhhHHHHHHHHhhHHHhhh
Q 046561          124 AWG---SLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDVQSKAR  171 (204)
Q Consensus       124 AwG---SLDALIGRLRAafEE~Gg~pE~NPF~araVRlYLReVRd~QAkAR  171 (204)
                      -|-   ++..+|--|++.+.+-   -..+|+-..|.++|..+-.+.+.+||
T Consensus        90 ~W~p~~~i~~il~~i~~ll~~p---~~~~~~n~~a~~~~~~~~~~f~~~~~  137 (140)
T PF00179_consen   90 SWSPSYTIESILLSIQSLLSEP---NPEDPLNEEAAELYKNDREEFEKKAR  137 (140)
T ss_dssp             TC-TTSHHHHHHHHHHHHHHST---CTTSTSSHHHHHHHHHCHHHHHHHHH
T ss_pred             cCCcccccccHHHHHHHHHhCC---CCCCcchHHHHHHHHHCHHHHHHHHH
Confidence            377   8888888999999554   45789999999999999777777775


No 65 
>PRK09468 ompR osmolarity response regulator; Provisional
Probab=24.65  E-value=59  Score=25.20  Aligned_cols=17  Identities=47%  Similarity=0.647  Sum_probs=13.3

Q ss_pred             hhHHHHHHHHHHHHHhC
Q 046561          127 SLDALIGRLRAAFEENG  143 (204)
Q Consensus       127 SLDALIGRLRAafEE~G  143 (204)
                      +||..|.|||.-++..+
T Consensus       201 ~l~~~i~~LR~kl~~~~  217 (239)
T PRK09468        201 SIDVQISRLRRLIEEDP  217 (239)
T ss_pred             CHHHHHHHHHHHhccCC
Confidence            68888999998886543


No 66 
>PRK11173 two-component response regulator; Provisional
Probab=24.09  E-value=62  Score=25.26  Aligned_cols=19  Identities=32%  Similarity=0.539  Sum_probs=15.9

Q ss_pred             hhHHHHHHHHHHHHHhCCC
Q 046561          127 SLDALIGRLRAAFEENGGK  145 (204)
Q Consensus       127 SLDALIGRLRAafEE~Gg~  145 (204)
                      +||..|.|||.-+++.+..
T Consensus       200 ~~~~~i~rlR~kl~~~~~~  218 (237)
T PRK11173        200 TVDVTIRRIRKHFESTPDT  218 (237)
T ss_pred             cHHHHHHHHHHHhccCCCC
Confidence            8999999999999865433


No 67 
>PF06947 DUF1290:  Protein of unknown function (DUF1290);  InterPro: IPR009709 This family consists of several bacterial small basic proteins of around 100 residues in length. The function of this family is unknown.
Probab=23.74  E-value=67  Score=25.31  Aligned_cols=17  Identities=35%  Similarity=0.782  Sum_probs=15.1

Q ss_pred             chhHHHHHHHHHHHHHh
Q 046561          126 GSLDALIGRLRAAFEEN  142 (204)
Q Consensus       126 GSLDALIGRLRAafEE~  142 (204)
                      ..||++.|-+||..|++
T Consensus        16 AaLDsvfGgiRA~le~~   32 (88)
T PF06947_consen   16 AALDSVFGGIRASLEDK   32 (88)
T ss_pred             HHHHHHHHHHHHHHHhh
Confidence            46999999999999975


No 68 
>PF02187 GAS2:  Growth-Arrest-Specific Protein 2 Domain;  InterPro: IPR003108 The growth-arrest-specific protein 2 domain is found associated with the spectrin repeat, calponin homology domain and EF hand in many proteins. It is found among others in the growth arrest-specific protein 2 [].; GO: 0007050 cell cycle arrest; PDB: 1V5R_A.
Probab=23.57  E-value=18  Score=27.27  Aligned_cols=13  Identities=46%  Similarity=1.234  Sum_probs=11.4

Q ss_pred             hhHHHHHHHhcCC
Q 046561           61 WNTFGQYLKNHRP   73 (204)
Q Consensus        61 wntf~qyL~n~rP   73 (204)
                      |.||.+||..|.|
T Consensus        56 W~tL~~~L~khDP   68 (73)
T PF02187_consen   56 WDTLEEYLDKHDP   68 (73)
T ss_dssp             EEEHHHHHHHH-H
T ss_pred             HHHHHHHhhccCC
Confidence            9999999999887


No 69 
>PF00667 FAD_binding_1:  FAD binding domain;  InterPro: IPR003097 This domain is found in sulphite reductase, NADPH cytochrome P450 reductase, nitric oxide synthase and methionine synthase reductase. Flavoprotein pyridine nucleotide cytochrome reductases [] (FPNCR) catalyse the interchange of reducing equivalents between one-electron carriers and the two-electron-carrying nicotinamide dinucleotides. The enzymes include ferredoxin:NADP+reductases (FNR) [], plant and fungal NAD(P)H:nitrate reductases [, ], NADH:cytochrome b5 reductases [], NADPH:P450 reductases [], NADPH:sulphite reductases [], nitric oxide synthases [], phthalate dioxygenase reductase [], and various other flavoproteins.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3QFR_B 3FJO_A 3QFC_B 3QE2_B 3QFS_A 3QFT_A 2B5O_B 2QTZ_A 2QTL_A 2BPO_B ....
Probab=23.51  E-value=71  Score=26.41  Aligned_cols=45  Identities=22%  Similarity=0.203  Sum_probs=32.8

Q ss_pred             chhHHHHHHhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcc
Q 046561           82 GAHVLEFLRYLDQFGKTKVHTPICPFYGHPNPPAPCPCPLRQAWG  126 (204)
Q Consensus        82 g~hVleFLrylDqfGkTkVH~~~C~ffG~p~ppapC~CPlRQAwG  126 (204)
                      .++|-+||..+.-.+.+.|......-.....++.|++|.++++--
T Consensus        56 ~~~V~~~l~~lgl~~d~~v~~~~~~~~~~~~~~~~~~~tl~~~l~  100 (219)
T PF00667_consen   56 PEEVERLLKRLGLDPDEPVTLKPKEQNNSVKPPFPSPITLRDLLT  100 (219)
T ss_dssp             HHHHHHHHHHHTSGTTSEEEEEESSTTSSCCSSSSSSEEHHHHHH
T ss_pred             HHHHHHHHHHhCCCcceEEEEEecccccccccccccceeeeeeee
Confidence            567888999888888777765555433555667888999988753


No 70 
>COG4865 Glutamate mutase epsilon subunit [Amino acid transport and metabolism]
Probab=23.37  E-value=54  Score=32.08  Aligned_cols=22  Identities=36%  Similarity=0.729  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHHhCCCCCCCccc
Q 046561          131 LIGRLRAAFEENGGKPEANPFG  152 (204)
Q Consensus       131 LIGRLRAafEE~Gg~pE~NPF~  152 (204)
                      +|.||--+|||||.+=...||+
T Consensus       196 YVDRL~G~YeE~Gi~INREpFg  217 (485)
T COG4865         196 YVDRLMGMYEEHGIRINREPFG  217 (485)
T ss_pred             HHHHHHhHHHhcCeeeccccCC
Confidence            4566667999999887766775


No 71 
>PF10520 Kua-UEV1_localn:  Kua-ubiquitin conjugating enzyme hybrid localisation domain;  InterPro: IPR019547  This entry represents part of the transcript of the fusion of two genes, the UEV1.  UEV1 is an enzymatically inactive variant of the E2 ubiquitin-conjugating enzymes that regulate non-canonical elongation of ubiquitin chains, and Kua, an otherwise unknown gene. UEV1A is a nuclear protein, whereas both Kua and Kua-UEV localise to cytoplasmic structures, indicating that the addition of a Kua domain to UEV confers new biological properties. UEV1-Kua carries the B domain with its characteristic double histidine motif, and it is probably this domain which determines the cytoplasmic localisation. It is postulated that this hybrid transcript could preferentially direct the variant polyubiquitination of substrates closely associated with the cytoplasmic face of the endoplasmic reticulum, possibly, although not necessarily, in conjunction with membrane-bound ubiquitin-conjugating enzymes []. 
Probab=23.34  E-value=39  Score=28.82  Aligned_cols=24  Identities=38%  Similarity=0.786  Sum_probs=21.7

Q ss_pred             hcchhHH-HHHHHHHHHHHhCCCCC
Q 046561          124 AWGSLDA-LIGRLRAAFEENGGKPE  147 (204)
Q Consensus       124 AwGSLDA-LIGRLRAafEE~Gg~pE  147 (204)
                      -|||+|- +||+.-++|.||-..|-
T Consensus        17 ~~Gs~~tpi~G~~I~~Fr~HH~~P~   41 (178)
T PF10520_consen   17 NWGSPDTPIIGKFIRPFREHHVDPT   41 (178)
T ss_pred             cCCCCccchhhHHhHHHHHcccCHH
Confidence            5899998 89999999999999875


No 72 
>PF07535 zf-DBF:  DBF zinc finger;  InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  In eukaryotes, initiation of DNA replication requires the assembly of pre-replication complexes (pre-RCs) on chromatin during the G1 phase. In the S phase, pre-RCs are activated by two protein kinases, Cdk2 and Cdc7, which results in the loading of replication factors and the unwinding of replication origins by the MCM helicase complex []. Cdc7 is a serine/threonine kinase that is conserved from yeast to human. It is regulated by its association with a regulatory subunit, the Dbf4 protein. This complex is often referred to as DDK (Dbf4-dependent kinase) []. DBF4 contains an N-terminal BRCT domain and a C-terminal conserved region that could potentially coordinate one zinc atom, the DBF4-type zinc finger. This entry represents the zinc finger, which is important for the interaction with Cdc7 [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding
Probab=23.20  E-value=41  Score=23.45  Aligned_cols=12  Identities=42%  Similarity=0.775  Sum_probs=10.4

Q ss_pred             cchhHHHHHHHH
Q 046561          125 WGSLDALIGRLR  136 (204)
Q Consensus       125 wGSLDALIGRLR  136 (204)
                      |-.||.||.+|.
T Consensus        37 f~~lD~li~~l~   48 (49)
T PF07535_consen   37 FKELDSLISQLQ   48 (49)
T ss_pred             HHHHHHHHHHhc
Confidence            778999999885


No 73 
>TIGR02384 RelB_DinJ addiction module antitoxin, RelB/DinJ family. Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. The resulting model appears to describe a narrower set of proteins than Pfam model pfam04221, although many in the scope of this model are not obviously paired with toxin proteins. Several toxin/antitoxin pairs may occur in a single species.
Probab=23.09  E-value=1.8e+02  Score=21.49  Aligned_cols=39  Identities=31%  Similarity=0.626  Sum_probs=28.7

Q ss_pred             HHHHHHHHHHHHhCCCCCCCccchhhHHHHHHHHhhHHHhhhccchhhh
Q 046561          130 ALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDVQSKARGISYEKK  178 (204)
Q Consensus       130 ALIGRLRAafEE~Gg~pE~NPF~araVRlYLReVRd~QAkARgi~y~kk  178 (204)
                      .|--..-++|+++|..+      ..|||++|+.|    ++-+|||++-+
T Consensus        12 ~lK~~a~~i~~~lGl~~------s~ai~~fl~qv----v~~~~lPF~~~   50 (83)
T TIGR02384        12 ELKKEAYAVFEELGLTP------STAIRMFLKQV----IREQGLPFDLR   50 (83)
T ss_pred             HHHHHHHHHHHHhCCCH------HHHHHHHHHHH----HHhCCCCCCcC
Confidence            34456677889999874      56999999976    34578887753


No 74 
>PF06480 FtsH_ext:  FtsH Extracellular;  InterPro: IPR011546 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This domain is found in the FtsH family of proteins that include FtsH a membrane-bound ATP-dependent protease universally conserved in prokaryotes []. The FtsH peptidases, which belong to MEROPS peptidase family M41 (clan MA(E)), efficiently degrade proteins that have a low thermodynamic stability - e.g. they lack robust unfoldase activity. This feature may be key and implies that this could be a criterion for degrading a protein. In Oenococcus oeni (Leuconostoc oenos) FtsH is involved in protection against environmental stress [], and shows increased expression under heat or osmotic stress. These two lines of evidence suggest that it is a fundamental prokaryotic self-protection mechanism that checks if proteins are correctly folded. The precise function of this N-terminal region is unclear. ; GO: 0004222 metalloendopeptidase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0016021 integral to membrane; PDB: 2LNA_A.
Probab=22.93  E-value=1.1e+02  Score=21.15  Aligned_cols=26  Identities=35%  Similarity=0.291  Sum_probs=18.7

Q ss_pred             cchhHHHHHHHHHHHHHhCCCCCCCc
Q 046561          125 WGSLDALIGRLRAAFEENGGKPEANP  150 (204)
Q Consensus       125 wGSLDALIGRLRAafEE~Gg~pE~NP  150 (204)
                      ++++|.+.-+|..+.+|+|..+++.|
T Consensus        84 ~~~~~~~~~~L~~~~~~~~v~~~~~~  109 (110)
T PF06480_consen   84 IPSVDSFDEFLIEALVEKGVKYESVP  109 (110)
T ss_dssp             -S-HHHHHHHHHHHHHHTT--TTT--
T ss_pred             CCCCHHHHHHHHHHHHHCCCccceec
Confidence            45699999999999999999988765


No 75 
>cd04383 RhoGAP_srGAP RhoGAP_srGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in srGAPs. srGAPs are components of the intracellular part of Slit-Robo signalling pathway that is important for axon guidance and cell migration. srGAPs contain an N-terminal FCH domain, a central RhoGAP domain and a C-terminal SH3 domain; this SH3 domain interacts with the intracellular proline-rich-tail of the Roundabout receptor (Robo). This interaction with Robo then activates the rhoGAP domain which in turn inhibits Cdc42 activity. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific group
Probab=22.90  E-value=97  Score=25.41  Aligned_cols=35  Identities=29%  Similarity=0.603  Sum_probs=24.8

Q ss_pred             HHHHHHHHHHHHhCCCC---CCCcc----chhhHHHHHHHHhh
Q 046561          130 ALIGRLRAAFEENGGKP---EANPF----GARAVRLYLREVRD  165 (204)
Q Consensus       130 ALIGRLRAafEE~Gg~p---E~NPF----~araVRlYLReVRd  165 (204)
                      .-|.+||..|+. |..+   +.+.+    .|..++.||||..+
T Consensus        47 ~~i~~l~~~~d~-g~~~~~~~~~~~d~~~va~lLK~fLReLPe   88 (188)
T cd04383          47 VEVNDIKNAFER-GEDPLADDQNDHDINSVAGVLKLYFRGLEN   88 (188)
T ss_pred             HHHHHHHHHHhc-CCCccccccccccHHHHHHHHHHHHHhCCC
Confidence            478999999986 4333   11222    68899999999754


No 76 
>KOG3816 consensus Cell differentiation regulator of the Headcase family [Signal transduction mechanisms]
Probab=22.82  E-value=1e+02  Score=30.56  Aligned_cols=83  Identities=25%  Similarity=0.338  Sum_probs=41.2

Q ss_pred             HHHHHHHhc---CCCC-------ccccCcchhHHHHHHhhcccC--cccccCCCCCCCCCCCCCCCCCCchhhhcchhHH
Q 046561           63 TFGQYLKNH---RPPL-------SLSRCSGAHVLEFLRYLDQFG--KTKVHTPICPFYGHPNPPAPCPCPLRQAWGSLDA  130 (204)
Q Consensus        63 tf~qyL~n~---rPPl-------sL~~csg~hVleFLrylDqfG--kTkVH~~~C~ffG~p~ppapC~CPlRQAwGSLDA  130 (204)
                      -+++||.|.   ++|+       .+..|--..+..-+. .-||+  -|.|..++-.|-            -|+-+-+|-.
T Consensus       274 ~~~~~l~N~~~l~~pk~~m~~q~~~r~~~~~~~pa~~~-~~~~~~~d~~vq~~~~vF~------------rRlD~s~lls  340 (526)
T KOG3816|consen  274 YLGEFLSNRSDLRWPKRDMGPQFELRCCIDPEIPAINV-DRQYYFEDETVQVNGSVFH------------RRLDYSNLLS  340 (526)
T ss_pred             HHHHHHhccccCCcchhhhcchhhhhhhcCcccchhhh-hccccccccceeeccceee------------ecccHHHHHh
Confidence            356788774   3343       344455555544442 22333  244555544443            4555666666


Q ss_pred             HHHHHHHHHHHhCCCCC-CCccchhhHHHHH
Q 046561          131 LIGRLRAAFEENGGKPE-ANPFGARAVRLYL  160 (204)
Q Consensus       131 LIGRLRAafEE~Gg~pE-~NPF~araVRlYL  160 (204)
                      +|=|-|  |+-.-.+=| .-|-+..-||++|
T Consensus       341 ~iPr~k--lN~~hVkmEDd~~~G~de~Rlfi  369 (526)
T KOG3816|consen  341 VIPRSK--LNGIHVKMEDDCPQGGDEVRLFI  369 (526)
T ss_pred             hccccc--ccceEEEecccCcCCccHHHHHH
Confidence            776543  222222322 3455556688875


No 77 
>cd04379 RhoGAP_SYD1 RhoGAP_SYD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in SYD-1_like proteins. Syd-1, first identified and best studied in C.elegans, has been shown to play an important role in neuronal development by specifying axonal properties. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=22.73  E-value=97  Score=26.13  Aligned_cols=39  Identities=36%  Similarity=0.409  Sum_probs=26.6

Q ss_pred             chhHHHHHHHHHHHHHhCCCCCC------Ccc-chhhHHHHHHHHhh
Q 046561          126 GSLDALIGRLRAAFEENGGKPEA------NPF-GARAVRLYLREVRD  165 (204)
Q Consensus       126 GSLDALIGRLRAafEE~Gg~pE~------NPF-~araVRlYLReVRd  165 (204)
                      |+. +.|..||..|+..+...+-      ++. .|..++.||||.-+
T Consensus        44 Gs~-~~i~~L~~~~d~~~~~~~l~~~~~~dvh~vA~lLK~fLReLPe   89 (207)
T cd04379          44 GSA-AKKKELRDAFERNSAAVELSEELYPDINVITGVLKDYLRELPE   89 (207)
T ss_pred             CcH-HHHHHHHHHHcCCCCcCCCChhhcccHHHHHHHHHHHHHhCCC
Confidence            444 3599999999986542221      222 58899999999654


No 78 
>PF01663 Phosphodiest:  Type I phosphodiesterase / nucleotide pyrophosphatase;  InterPro: IPR002591 This family consists of phosphodiesterases, including human plasma-cell membrane glycoprotein PC-1 / alkaline phosphodiesterase I / nucleotide pyrophosphatase (nppase). These enzymes catalyse the cleavage of phosphodiester and phosphosulphate bonds in NAD, deoxynucleotides and nucleotide sugars []. Another member of this family is ATX an autotaxin, tumor cell motility-stimulating protein which exhibits type I phosphodiesterases activity []. The alignment encompasses the active site [, ]. Also present within this family is 60 kDa Ca2+-ATPase from Myroides odoratus [].  This signature also hits a number of ethanolamine phosphate transferase involved in glycosylphosphatidylinositol-anchor biosynthesis.; GO: 0003824 catalytic activity; PDB: 2XRG_A 2XR9_A 3T02_A 3T01_A 3SZZ_A 3SZY_A 3T00_A 3NKM_A 3NKN_A 3NKR_A ....
Probab=22.57  E-value=65  Score=26.70  Aligned_cols=27  Identities=37%  Similarity=0.610  Sum_probs=23.2

Q ss_pred             hhhhcchhHHHHHHHHHHHHHhCCCCC
Q 046561          121 LRQAWGSLDALIGRLRAAFEENGGKPE  147 (204)
Q Consensus       121 lRQAwGSLDALIGRLRAafEE~Gg~pE  147 (204)
                      .+++.-.+|..||+|.+++++.|...+
T Consensus       208 ~~~~~~~~D~~ig~l~~~l~~~~~~~~  234 (365)
T PF01663_consen  208 IEDAYRRIDQAIGRLLEALDENGLLED  234 (365)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTT-TTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhCCCCc
Confidence            688999999999999999999976644


No 79 
>cd04399 RhoGAP_fRGD2 RhoGAP_fRGD2: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal RGD2-like proteins. Yeast Rgd2 is a GAP protein for Cdc42 and Rho5. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=22.34  E-value=90  Score=26.29  Aligned_cols=35  Identities=31%  Similarity=0.465  Sum_probs=25.5

Q ss_pred             HHHHHHHHHHHHhCCCCC--------CCc-cchhhHHHHHHHHhh
Q 046561          130 ALIGRLRAAFEENGGKPE--------ANP-FGARAVRLYLREVRD  165 (204)
Q Consensus       130 ALIGRLRAafEE~Gg~pE--------~NP-F~araVRlYLReVRd  165 (204)
                      +-|-.||.+|++ |..+.        .++ -.|.++|+||||.-|
T Consensus        51 ~~i~~Lr~~~d~-~~~~~~~~~~~~~~dv~~va~~LK~ylReLPe   94 (212)
T cd04399          51 KETHQLRNLLNK-PKKPDKEVIILKKFEPSTVASVLKLYLLELPD   94 (212)
T ss_pred             HHHHHHHHHHcC-CCCcchhhhccccCCHHHHHHHHHHHHHHCCC
Confidence            568899999997 43331        223 378899999999765


No 80 
>PF12067 Sox_C_TAD:  Sox C-terminal transactivation domain;  InterPro: IPR021934 The Sox family of high mobility group (HMG) box transcription factors that are homologous to the Y-chromosome encoded sex- determining factor SRY plays important roles in embryonic development. Sox18, together with Sox7 and -17, constitutes the subgroup F within this family. Bioinformatic analysis of the C-termini of subgroup F Sox family members from different species including humans, mice, rat, chicken and Xenopus revealed three conserved blocks including highly conserved residues. They were termed proline, charged, and serine according to the predominance of the respective amino acids. The charged block comprises a strong transactivating domain []. This entry covers the entire Sox C-terminal domain, and was previously annotated as DUF3547.
Probab=21.82  E-value=49  Score=28.81  Aligned_cols=17  Identities=35%  Similarity=0.501  Sum_probs=12.3

Q ss_pred             hhhhhhHHHHHHHhcCC
Q 046561           57 KRRDWNTFGQYLKNHRP   73 (204)
Q Consensus        57 KRrdwntf~qyL~n~rP   73 (204)
                      ---|.++|.|||...+.
T Consensus       139 geVDR~EFdQYLn~~~~  155 (197)
T PF12067_consen  139 GEVDRTEFDQYLNSSRC  155 (197)
T ss_pred             hhhhHHHHHHHhccccC
Confidence            33478999999996443


No 81 
>PRK13977 myosin-cross-reactive antigen; Provisional
Probab=21.75  E-value=1.1e+02  Score=30.57  Aligned_cols=101  Identities=15%  Similarity=0.147  Sum_probs=60.2

Q ss_pred             hhhhHHHHHHHhcCCCCcccc-------Ccchh-HHHHHHhhccc--CcccccCCCCCCCCCCCCCCCCCCchhhhcchh
Q 046561           59 RDWNTFGQYLKNHRPPLSLSR-------CSGAH-VLEFLRYLDQF--GKTKVHTPICPFYGHPNPPAPCPCPLRQAWGSL  128 (204)
Q Consensus        59 rdwntf~qyL~n~rPPlsL~~-------csg~h-VleFLrylDqf--GkTkVH~~~C~ffG~p~ppapC~CPlRQAwGSL  128 (204)
                      .|-.++.+|+..+....++..       .-..| ..||+||+-+|  ---..+...|-.|...++              -
T Consensus       160 Ld~~tI~d~f~~~Ff~t~Fw~~w~t~FaF~~whSA~E~rry~~rf~~~~~~l~~~s~l~ft~ynq--------------y  225 (576)
T PRK13977        160 LDDKTIEDWFSPEFFETNFWYYWRTMFAFEKWHSALEMRRYMHRFIHHIGGLPDLSGLKFTKYNQ--------------Y  225 (576)
T ss_pred             hCCcCHHHHHhhcCchhHHHHHHHHHHCCchhhHHHHHHHHHHHHHHhhccCCccccccCCCCCc--------------h
Confidence            344567777777666443221       11111 56788888776  223355556666655553              4


Q ss_pred             HHHHHHHHHHHHHhCCCCCCCccchhhHHHHHHHHhhHHHhhhccchhh
Q 046561          129 DALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDVQSKARGISYEK  177 (204)
Q Consensus       129 DALIGRLRAafEE~Gg~pE~NPF~araVRlYLReVRd~QAkARgi~y~k  177 (204)
                      |+||.-|+...+++|++=..|   .++.+|. .+..+.+-++.||-+++
T Consensus       226 eSLV~PL~~~Le~~GV~f~~~---t~VtdL~-~~~d~~~~~VtgI~~~~  270 (576)
T PRK13977        226 ESLVLPLIKYLEDHGVDFQYG---TKVTDID-FDITGGKKTATAIHLTR  270 (576)
T ss_pred             hHHHHHHHHHHHhCCCEEEeC---CEEEEEE-EcCCCCceEEEEEEEEe
Confidence            999999999999999864432   3333332 12223456788888864


No 82 
>cd04390 RhoGAP_ARHGAP22_24_25 RhoGAP_ARHGAP22_24_25:  GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP22, 24 and 25-like proteins; longer isoforms of these proteins contain an additional N-terminal pleckstrin homology (PH) domain. ARHGAP25 (KIA0053) has been identified as a GAP for Rac1 and Cdc42. Short isoforms (without the PH domain) of ARHGAP24, called RC-GAP72 and p73RhoGAP, and of ARHGAP22, called p68RacGAP, has been shown to be involved in angiogenesis and endothelial cell capillary formation. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the r
Probab=21.51  E-value=1.4e+02  Score=24.37  Aligned_cols=37  Identities=27%  Similarity=0.506  Sum_probs=26.4

Q ss_pred             HHHHHHHHHHHHHhCCC---CCCCcc-chhhHHHHHHHHhh
Q 046561          129 DALIGRLRAAFEENGGK---PEANPF-GARAVRLYLREVRD  165 (204)
Q Consensus       129 DALIGRLRAafEE~Gg~---pE~NPF-~araVRlYLReVRd  165 (204)
                      .+.|.+||.+|+.....   .+.+|. .|..++.||||.-+
T Consensus        50 ~~~i~~l~~~~d~~~~~~~~~~~d~h~va~lLK~fLReLPe   90 (199)
T cd04390          50 ANLVKQLQDAFDAGERPSFDSDTDVHTVASLLKLYLRELPE   90 (199)
T ss_pred             HHHHHHHHHHHhCCCCCCccccCCHHHHHHHHHHHHHhCCC
Confidence            45789999999753321   234553 78899999998754


No 83 
>cd08802 Death_UNC5B Death domain found in Uncoordinated-5B. Death Domain (DD) found in Uncoordinated-5B (UNC5B). UNC5B is part of the UNC-5 homolog family. It is a receptor for the secreted netrin-1 and plays a role in axonal guidance, angiogenesis, and apoptosis. UNC5B signaling is involved in the netrin-1-induced proliferation and migration of renal proximal tubular cells. It is also required for vascular patterning during embryonic development, and its activation inhibits sprouting angiogenesis. UNC5 proteins are transmembrane proteins with an extracellular domain consisting of two immunoglobulin repeats, two thrombospondin type-I modules and an intracellular region containing a ZU-5 domain, UPA domain and a DD. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activatio
Probab=20.90  E-value=59  Score=24.88  Aligned_cols=17  Identities=35%  Similarity=0.466  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHhCCC
Q 046561          129 DALIGRLRAAFEENGGK  145 (204)
Q Consensus       129 DALIGRLRAafEE~Gg~  145 (204)
                      |+-||+|.++++|+|+.
T Consensus        60 ~~~v~~L~~~L~~mgR~   76 (84)
T cd08802          60 DGDLNSLASALEEMGKS   76 (84)
T ss_pred             cccHHHHHHHHHHcCcc
Confidence            45689999999999975


No 84 
>cd08782 Death_DAPK1 Death domain found in death-associated protein kinase 1. Death domain (DD) found in death-associated protein kinase 1 (DAPK1). DAPK1 is composed of several functional domains, including a kinase domain, a CaM regulatory domain, ankyrin repeats, a cytoskeletal binding domain and a C-terminal DD. It plays important roles in a diverse range of signal transduction pathways including apoptosis, growth factor signalling, and autophagy. Loss of DAPK1 expression, usually because of DNA methylation, is implicated in many tumor types. DAPK1 is highly abundant in the brain and has also been associated with neurodegeneration. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as ad
Probab=20.81  E-value=52  Score=24.49  Aligned_cols=28  Identities=29%  Similarity=0.440  Sum_probs=23.7

Q ss_pred             CCchhhhcchhH-HHHHHHHHHHHHhCCC
Q 046561          118 PCPLRQAWGSLD-ALIGRLRAAFEENGGK  145 (204)
Q Consensus       118 ~CPlRQAwGSLD-ALIGRLRAafEE~Gg~  145 (204)
                      +|-+=+-|+.-+ +-||.|-.+.+|+|+.
T Consensus        47 T~~LL~~W~~~~~~tvg~L~~~L~~~gR~   75 (82)
T cd08782          47 TDALLQEWATAPPSTIGTLIDKLRELGRE   75 (82)
T ss_pred             HHHHHHHHhcCCcccHHHHHHHHHHcCcH
Confidence            455777899877 9999999999999974


No 85 
>PF01754 zf-A20:  A20-like zinc finger;  InterPro: IPR002653 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in A20. A20 is an inhibitor of cell death that inhibits NF-kappaB activation via the tumour necrosis factor receptor associated factor pathway []. The zinc finger domains appear to mediate self-association in A20. These fingers also mediate IL-1-induced NF-kappa B activation. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 2FIF_F 2FID_B 2C7N_C 2C7M_A 2L00_A 2KZY_A 2EQG_A 2EQE_A 3OJ3_J 3OJ4_C ....
Probab=20.64  E-value=43  Score=20.68  Aligned_cols=16  Identities=38%  Similarity=0.885  Sum_probs=10.4

Q ss_pred             CCCCCCCCCCCCCCCC
Q 046561          102 TPICPFYGHPNPPAPC  117 (204)
Q Consensus       102 ~~~C~ffG~p~ppapC  117 (204)
                      ..+|.|||.+..-.-|
T Consensus         5 ~~gCgf~Gs~~~~~~C   20 (25)
T PF01754_consen    5 ANGCGFYGSPATNGLC   20 (25)
T ss_dssp             TTTSSSB-BGGGTTS-
T ss_pred             cCCCCCcccccccCcc
Confidence            5789999988754444


No 86 
>PF13099 DUF3944:  Domain of unknown function (DUF3944)
Probab=20.56  E-value=54  Score=21.87  Aligned_cols=22  Identities=27%  Similarity=0.599  Sum_probs=15.5

Q ss_pred             ccCcchhHHHHHHhh--cccCccc
Q 046561           78 SRCSGAHVLEFLRYL--DQFGKTK   99 (204)
Q Consensus        78 ~~csg~hVleFLryl--DqfGkTk   99 (204)
                      ..|+..|+-++..+|  |..|+++
T Consensus        11 ~~cs~edL~~L~~~Lt~dkdG~~R   34 (35)
T PF13099_consen   11 AECSNEDLKDLVDILTHDKDGKKR   34 (35)
T ss_pred             HHCCHHHHHHHHHHHhcCCCCCcC
Confidence            368888877665554  7888764


No 87 
>cd04406 RhoGAP_myosin_IXA RhoGAP_myosin_IXA: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXA. Class IX myosins contain a characteristic head domain, a neck domain and a tail domain which contains a C6H2-zinc binding motif and a Rho-GAP domain. Class IX myosins are single-headed, processive myosins that are partly cytoplasmic, and partly associated with membranes and the actin cytoskeleton. Class IX myosins are implicated in the regulation of neuronal morphogenesis and function of sensory systems, like the inner ear. There are two major isoforms, myosin IXA and IXB with several splice variants, which are both expressed in developing neurons. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell prolife
Probab=20.46  E-value=1.1e+02  Score=25.20  Aligned_cols=36  Identities=19%  Similarity=0.310  Sum_probs=25.1

Q ss_pred             HHHHHHHHHHHHhCCCCC---CCcc-chhhHHHHHHHHhh
Q 046561          130 ALIGRLRAAFEENGGKPE---ANPF-GARAVRLYLREVRD  165 (204)
Q Consensus       130 ALIGRLRAafEE~Gg~pE---~NPF-~araVRlYLReVRd  165 (204)
                      ..|..|+..|+..+....   .++. .+..++.||||.-+
T Consensus        44 ~~i~~l~~~~d~~~~~~~~~~~d~h~va~lLK~fLReLPe   83 (186)
T cd04406          44 NKIKELRQGLDTDANSVNLDDYNIHVIASVFKQWLRDLPN   83 (186)
T ss_pred             HHHHHHHHHHccCCCCCCcccCCHHHHHHHHHHHHHhCCC
Confidence            458899999987543322   2333 78899999999854


No 88 
>PF12055 DUF3536:  Domain of unknown function (DUF3536);  InterPro: IPR021923  This presumed domain is functionally uncharacterised. This domain is found in bacteria and archaea. This domain is typically between 274 to 285 amino acids in length. This domain is found associated with PF03065 from PFAM. 
Probab=20.37  E-value=74  Score=29.15  Aligned_cols=42  Identities=45%  Similarity=0.698  Sum_probs=33.6

Q ss_pred             chhhhcchhHHHHHHHHHHHHHhCCCCCCCccchhhHHHHHHHHhhH
Q 046561          120 PLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDV  166 (204)
Q Consensus       120 PlRQAwGSLDALIGRLRAafEE~Gg~pE~NPF~araVRlYLReVRd~  166 (204)
                      |||.|   ||.|-.+|..+||+.|+.=-.+|..+|-  -|.+-|-+.
T Consensus         8 PLR~A---ld~Lrd~l~~~fe~~~~~l~~Dpw~ar~--~Yi~Vil~~   49 (285)
T PF12055_consen    8 PLREA---LDWLRDRLDELFEEEGGELFKDPWAARD--EYIEVILDR   49 (285)
T ss_pred             HHHHH---HHHHHHHHHHHHHHHHHHhcCCHHHHHH--HHHHHHcCC
Confidence            56654   8999999999999999876678987764  677777655


No 89 
>cd08799 Death_UNC5C Death domain found in Uncoordinated-5C. Death Domain (DD) found in Uncoordinated-5C (UNC5C). UNC5C is part of the UNC-5 homolog family. It is a receptor for the secreted netrin-1 and plays a role in axonal guidance, angiogenesis, and apoptosis. UNC5C plays a critical role in the development of spinal accesory motor neurons. Methylation of the UNC5C gene is associated with early stages of colorectal carcinogenesis. UNC5 proteins are transmembrane proteins with an extracellular domain consisting of two immunoglobulin repeats, two thrombospondin type-I modules and an intracellular region containing a ZU-5 domain, UPA domain and a DD. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN.
Probab=20.36  E-value=54  Score=24.97  Aligned_cols=17  Identities=41%  Similarity=0.573  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHHHhCCC
Q 046561          129 DALIGRLRAAFEENGGK  145 (204)
Q Consensus       129 DALIGRLRAafEE~Gg~  145 (204)
                      |+-||+|..+++|+|+.
T Consensus        60 ~~tv~~L~~~L~emgR~   76 (84)
T cd08799          60 DGNLSRLAAVLEEMGRH   76 (84)
T ss_pred             CCcHHHHHHHHHHcCCc
Confidence            56699999999999975


No 90 
>PF00618 RasGEF_N:  RasGEF N-terminal motif;  InterPro: IPR000651  The crystal structure of the guanine nucleotide exchange factor (GEF) region of human Sos1 complexes with Ras has been solved []. The structure consists of two distinct alpha helical structural domains: the N-terminal domain which seems to have a purely structural role and the C-terminal domain which is sufficient for catalytic activity and contains all residues that interact with Ras. A main feature of the catalytic domain is the protrusion of a helical hairpin important for the nucleotide-exchange mechanism. The N-terminal domain is likely to be important for the stability and correct placement of the hairpin structure.   This entry represents a domain found in several GEF for Ras-like small GTPases which lies N-terminal to the RasGef (Cdc25-like) domain. ; GO: 0005085 guanyl-nucleotide exchange factor activity, 0051056 regulation of small GTPase mediated signal transduction, 0005622 intracellular; PDB: 3CF6_E 2BYV_E 1NVW_S 1BKD_S 1XDV_A 2II0_A 1NVU_S 1NVX_S 1NVV_S 1XD4_B ....
Probab=20.19  E-value=61  Score=23.21  Aligned_cols=12  Identities=50%  Similarity=0.736  Sum_probs=6.7

Q ss_pred             cchhHHHHHHHH
Q 046561          125 WGSLDALIGRLR  136 (204)
Q Consensus       125 wGSLDALIGRLR  136 (204)
                      .||||+||.+|=
T Consensus         4 ~gtl~~Li~~L~   15 (104)
T PF00618_consen    4 AGTLEKLIERLT   15 (104)
T ss_dssp             EE-HHHHHHHHC
T ss_pred             eeCHHHHHHHHh
Confidence            366666666664


No 91 
>PF10774 DUF4226:  Domain of unknown function (DUF4226);  InterPro: IPR019710 This entry represents an uncharacterised family of proteins belonging to Mycobacteria. It was previously incorrectly annotated as Biofilm regulator BssS (also known as YliH). 
Probab=20.11  E-value=1.5e+02  Score=23.69  Aligned_cols=34  Identities=32%  Similarity=0.494  Sum_probs=29.5

Q ss_pred             hhHHHHHHHHHHHHHhCCCCCCCccchhhHHHHHH
Q 046561          127 SLDALIGRLRAAFEENGGKPEANPFGARAVRLYLR  161 (204)
Q Consensus       127 SLDALIGRLRAafEE~Gg~pE~NPF~araVRlYLR  161 (204)
                      .||+||..++++....+. --.-|.|+|.+--||+
T Consensus        48 ~Ld~i~aeI~~Av~~~~~-aldTPaG~r~f~~fL~   81 (112)
T PF10774_consen   48 RLDAIQAEIEAAVAAQAP-ALDTPAGAREFQRFLR   81 (112)
T ss_pred             HHHHHHHHHHHHHHhccc-ccCCHHHHHHHHHHHH
Confidence            799999999999988876 4578999999888875


No 92 
>KOG4329 consensus DNA-binding protein [General function prediction only]
Probab=20.07  E-value=57  Score=31.85  Aligned_cols=31  Identities=29%  Similarity=0.375  Sum_probs=26.7

Q ss_pred             CcchhHHHHHHhhcccCcccccCCCCCCCCCC
Q 046561           80 CSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  111 (204)
Q Consensus        80 csg~hVleFLrylDqfGkTkVH~~~C~ffG~p  111 (204)
                      -....|++|| ++++-|.++-|.+.|+--|.-
T Consensus       211 lpedEVie~l-~k~v~~~~~~~~~p~~P~gt~  241 (445)
T KOG4329|consen  211 LPEDEVIEFL-LKAVVRLRKEHDQPCPPEGTE  241 (445)
T ss_pred             CchHHHHHHH-HHHHHhhhcccCCCCCCcccc
Confidence            3467899999 999999999999999877754


Done!