BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 046562
(180 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3KL9|A Chain A, Crystal Structure Of Pepa From Streptococcus Pneumoniae
pdb|3KL9|B Chain B, Crystal Structure Of Pepa From Streptococcus Pneumoniae
pdb|3KL9|C Chain C, Crystal Structure Of Pepa From Streptococcus Pneumoniae
pdb|3KL9|D Chain D, Crystal Structure Of Pepa From Streptococcus Pneumoniae
pdb|3KL9|E Chain E, Crystal Structure Of Pepa From Streptococcus Pneumoniae
pdb|3KL9|F Chain F, Crystal Structure Of Pepa From Streptococcus Pneumoniae
pdb|3KL9|G Chain G, Crystal Structure Of Pepa From Streptococcus Pneumoniae
pdb|3KL9|H Chain H, Crystal Structure Of Pepa From Streptococcus Pneumoniae
pdb|3KL9|I Chain I, Crystal Structure Of Pepa From Streptococcus Pneumoniae
pdb|3KL9|J Chain J, Crystal Structure Of Pepa From Streptococcus Pneumoniae
pdb|3KL9|K Chain K, Crystal Structure Of Pepa From Streptococcus Pneumoniae
pdb|3KL9|L Chain L, Crystal Structure Of Pepa From Streptococcus Pneumoniae
Length = 355
Score = 26.9 bits (58), Expect = 6.6, Method: Compositional matrix adjust.
Identities = 27/102 (26%), Positives = 43/102 (42%), Gaps = 8/102 (7%)
Query: 50 TSAITVAGKDGPTSHILRFGTIAVVDDAVTEGP----TIDSKQIGRAQGIYVNSQLDGKA 105
T V+G + P LR VD+ VT+G I + A + V S +D
Sbjct: 13 TELAAVSGHEAPVRAYLREKLTPHVDEVVTDGLGGIFGIKHSEAVDAPRVLVASHMD--E 70
Query: 106 LYMAFSLIFTDGEFKGSTLEIQGSDIFAMKQREFGVVSGTGH 147
+ S I DG F+ +EI G + + + F +++ GH
Sbjct: 71 VGFMVSEIKPDGTFR--VVEIGGWNPMVVSSQRFKLLTRDGH 110
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.137 0.392
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,950,497
Number of Sequences: 62578
Number of extensions: 200042
Number of successful extensions: 511
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 510
Number of HSP's gapped (non-prelim): 5
length of query: 180
length of database: 14,973,337
effective HSP length: 93
effective length of query: 87
effective length of database: 9,153,583
effective search space: 796361721
effective search space used: 796361721
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)