Citrus Sinensis ID: 046599


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MSRVYVGNLDSRVSERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDYRDAQDAIRELDGKNGWRVELSHNSRGGGGGRGGGRGRSGGSDLKCYECGEPGHFARECRLRGGSGRRRSRSPRYRRSPSYGRR
cccEEEccccccccHHHHHHHHHccccEEEEEEccccccEEEEEEccHHHHHHHHHHHccccccEEEEECcccccccccccccccccccccccCCcccccccccccccccccccccccccccccccccccc
MSRVYVGNLDSRVSERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDYRDAQDAIRELDGKNGW****************************CYECGEPGHF*****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRVYVGNLDSRVSERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDYRDAQDAIRELDGKNGWRVELSHNSRGGGGGRGGGRGRSGGSDLKCYECGEPGHFARECRLRGGSGRRRSRSPRYRRSPSYGRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/arginine-rich splicing factor RSZ22 Sequence-specific RNA-binding protein probably involved in pre-mRNA splicing. In vitro, can complement efficiently splicing-deficient mammalian SRSF7-depleted HeLa cell extract.probableO81126
Serine/arginine-rich splicing factor RSZ23 Involved in pre-mRNA splicing. In protoplast assay, enhances splicing efficiency of WAXY intron 1 and alters the selection of the 5'-splice sites by stimulating site 1 (proximal site).probableQ6K9C3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HVZ, chain A
Confidence level:very confident
Coverage over the Query: 2-73
View the alignment between query and template
View the model in PyMOL
Template: 1CL4, chain A
Confidence level:confident
Coverage over the Query: 89-110
View the alignment between query and template
View the model in PyMOL