BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046615
         (409 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3C6C|A Chain A, Crystal Structure Of A Putative 3-Keto-5-Aminohexanoate
           Cleavage Enzyme (Reut_c6226) From Ralstonia Eutropha
           Jmp134 At 1.72 A Resolution
          Length = 316

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 88  LADLQQALEDYLPILLGL-VENGNQLQDKLQFPWLN 122
           +A+  + LED LP +  L +  GNQ++ KL+F +LN
Sbjct: 129 VAERVKHLEDCLPEIASLDITTGNQVEGKLEFVYLN 164


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.135    0.406 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,336,739
Number of Sequences: 62578
Number of extensions: 425959
Number of successful extensions: 1217
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 1213
Number of HSP's gapped (non-prelim): 5
length of query: 409
length of database: 14,973,337
effective HSP length: 101
effective length of query: 308
effective length of database: 8,652,959
effective search space: 2665111372
effective search space used: 2665111372
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)