BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 046658
(413 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1B92|A Chain A, Mobility Of An Hiv-1 Integrase Active Site Loop Is
Correlated With Catalytic Activity
Length = 163
Score = 28.9 bits (63), Expect = 4.9, Method: Compositional matrix adjust.
Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 4/67 (5%)
Query: 287 ELTFLEVKLAGSGWRVLPIILHSSPNLERLLVDKECWFEITKEQFGW---IESDCVPQCL 343
E + +KLAG W V + + N V CW+ K++FG +S V + +
Sbjct: 47 ETAYFLLKLAGR-WPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQAVIESM 105
Query: 344 LQRVKKI 350
+ +KKI
Sbjct: 106 NKELKKI 112
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.138 0.430
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,653,872
Number of Sequences: 62578
Number of extensions: 452837
Number of successful extensions: 1135
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1134
Number of HSP's gapped (non-prelim): 3
length of query: 413
length of database: 14,973,337
effective HSP length: 101
effective length of query: 312
effective length of database: 8,652,959
effective search space: 2699723208
effective search space used: 2699723208
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)