Query 046678
Match_columns 74
No_of_seqs 100 out of 132
Neff 6.5
Searched_HMMs 46136
Date Fri Mar 29 03:22:20 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/046678.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/046678hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF07333 SLR1-BP: S locus-rela 99.1 1.3E-10 2.9E-15 65.0 3.5 44 28-74 9-58 (58)
2 PF00304 Gamma-thionin: Gamma- 98.4 2.3E-07 5E-12 50.0 2.4 35 35-74 13-47 (47)
3 PF10868 DUF2667: Protein of u 98.0 5E-06 1.1E-10 50.6 2.8 49 25-73 27-80 (90)
4 cd00107 Knot1 The "knottin" fo 97.1 0.00073 1.6E-08 33.6 2.7 32 35-71 2-33 (33)
5 smart00505 Knot1 Knottins. Kno 96.1 0.0058 1.3E-07 31.8 2.3 33 35-72 12-45 (45)
6 PF00451 Toxin_2: Scorpion sho 94.0 0.071 1.5E-06 26.6 2.4 30 35-71 2-32 (32)
7 PF07127 Nodulin_late: Late no 93.8 0.059 1.3E-06 29.4 2.2 47 1-57 1-49 (54)
8 PF11415 Toxin_37: Antifungal 91.8 0.14 3E-06 26.0 1.7 30 36-73 1-33 (35)
9 PF01097 Defensin_2: Arthropod 91.7 0.31 6.6E-06 24.6 2.9 27 39-71 8-34 (34)
10 PF14865 Macin: Macin; PDB: 2K 84.7 0.94 2E-05 25.6 2.1 18 40-57 22-39 (59)
11 PF00537 Toxin_3: Scorpion tox 83.2 1.7 3.7E-05 23.8 2.7 36 35-72 14-49 (54)
12 PF08027 Albumin_I: Albumin I; 74.1 1.1 2.4E-05 28.5 0.2 33 23-58 15-53 (120)
13 PF08119 Toxin_31: Scorpion ac 71.3 0.43 9.3E-06 24.0 -1.8 26 40-71 11-36 (37)
14 PF06607 Prokineticin: Prokine 71.1 2.3 4.9E-05 26.1 1.0 10 29-38 25-34 (97)
15 PF04202 Mfp-3: Foot protein 3 70.2 4.6 9.9E-05 23.4 2.1 15 1-15 1-15 (71)
16 PF08086 Toxin_17: Ergtoxin fa 69.7 6.6 0.00014 20.3 2.4 18 40-57 18-35 (41)
17 PF02402 Lysis_col: Lysis prot 65.4 2.1 4.5E-05 23.0 0.0 15 1-15 1-16 (46)
18 PF08194 DIM: DIM protein; In 64.4 7.1 0.00015 19.9 1.9 18 1-18 1-18 (36)
19 PF14866 Toxin_38: Potassium c 63.0 5.5 0.00012 22.3 1.4 26 39-72 29-54 (56)
20 PF06876 SCRL: Plant self-inco 61.8 1.4 3.1E-05 24.6 -1.1 42 29-72 17-67 (67)
21 PF05294 Toxin_5: Scorpion sho 59.8 16 0.00035 18.1 2.6 20 44-70 13-32 (32)
22 PF03032 Brevenin: Brevenin/es 57.5 7.4 0.00016 20.8 1.3 17 1-17 3-19 (46)
23 PF12071 DUF3551: Protein of u 51.1 49 0.0011 19.5 4.3 53 1-57 1-65 (82)
24 PF13956 Ibs_toxin: Toxin Ibs, 50.8 7.7 0.00017 17.0 0.6 7 1-7 1-7 (19)
25 PF15284 PAGK: Phage-encoded v 49.6 22 0.00048 20.2 2.5 12 1-12 1-12 (61)
26 PF09889 DUF2116: Uncharacteri 46.4 18 0.00039 20.2 1.8 11 2-12 36-46 (59)
27 TIGR02052 MerP mercuric transp 46.1 17 0.00036 19.6 1.7 10 1-10 1-10 (92)
28 PF10690 Myticin-prepro: Mytic 45.9 14 0.0003 22.7 1.3 22 35-57 24-45 (98)
29 COG5341 Uncharacterized protei 45.2 19 0.00041 23.3 1.9 18 7-24 21-38 (132)
30 PRK09810 entericidin A; Provis 43.1 29 0.00063 18.1 2.2 6 1-6 2-7 (41)
31 PHA03399 pif3 per os infectivi 42.4 25 0.00055 24.2 2.4 28 30-57 53-87 (200)
32 PF11777 DUF3316: Protein of u 41.3 30 0.00065 21.2 2.4 12 1-12 1-12 (114)
33 PF12393 Dr_adhesin: Dr family 39.5 41 0.00088 15.1 2.3 12 1-12 1-12 (21)
34 PRK11029 FtsH protease regulat 39.3 30 0.00065 25.3 2.5 23 1-23 1-24 (334)
35 PF12099 DUF3575: Protein of u 39.1 23 0.0005 23.7 1.7 14 1-14 1-14 (189)
36 PRK09838 periplasmic copper-bi 37.1 37 0.0008 21.2 2.3 18 1-18 1-18 (115)
37 PF00066 Notch: LNR domain; I 36.7 13 0.00028 18.9 0.2 17 40-57 4-22 (38)
38 PHA02291 hypothetical protein 34.9 32 0.00069 21.9 1.8 13 3-15 4-16 (132)
39 PF12606 RELT: Tumour necrosis 32.9 39 0.00085 18.3 1.7 9 24-32 25-33 (50)
40 smart00286 PTI Plant trypsin i 32.5 10 0.00023 18.4 -0.5 24 29-52 2-26 (29)
41 PF11587 Prion_bPrPp: Major pr 32.0 15 0.00031 17.9 -0.1 10 1-10 1-10 (29)
42 PF11714 Inhibitor_I53: Thromb 30.7 38 0.00083 19.8 1.5 6 1-6 1-6 (78)
43 PF00008 EGF: EGF-like domain 30.5 30 0.00066 16.4 1.0 18 52-71 8-25 (32)
44 TIGR01932 hflC HflC protein. H 30.1 52 0.0011 23.5 2.5 26 1-26 1-27 (317)
45 PF07437 YfaZ: YfaZ precursor; 29.8 54 0.0012 21.9 2.4 15 1-15 1-15 (180)
46 KOG3384 Selenoprotein [General 29.4 29 0.00062 23.0 0.9 32 1-32 1-32 (154)
47 PF09253 Ole-e-6: Pollen aller 29.4 14 0.0003 19.3 -0.4 17 40-56 3-19 (41)
48 PF03058 Sar8_2: Sar8.2 family 29.1 41 0.0009 20.5 1.5 15 13-27 18-32 (93)
49 PF11466 Doppel: Prion-like pr 28.6 36 0.00078 16.6 1.0 9 13-21 15-23 (30)
50 TIGR01655 yxeA_fam conserved h 28.3 46 0.00099 20.5 1.7 8 1-8 1-8 (114)
51 PF05540 Serpulina_VSP: Serpul 28.2 49 0.0011 24.9 2.1 21 1-21 1-22 (377)
52 PF13985 YbgS: YbgS-like prote 28.1 63 0.0014 20.7 2.3 17 1-17 1-17 (122)
53 COG2143 Thioredoxin-related pr 27.7 58 0.0013 22.1 2.2 12 1-12 1-12 (182)
54 PF07974 EGF_2: EGF-like domai 27.6 50 0.0011 15.9 1.4 16 51-71 9-24 (32)
55 PF10917 DUF2708: Protein of u 26.6 24 0.00051 18.6 0.1 7 25-31 19-25 (43)
56 TIGR03656 IsdC heme uptake pro 26.4 57 0.0012 22.8 2.0 9 1-9 1-9 (217)
57 PLN00214 putative protein; Pro 26.2 28 0.00061 22.1 0.5 12 1-12 1-14 (115)
58 PHA03066 Hypothetical protein; 25.8 79 0.0017 19.9 2.4 17 1-17 1-17 (110)
59 PF08120 Toxin_32: Tamulustoxi 25.8 19 0.00041 17.8 -0.3 28 41-71 6-34 (35)
60 PF11839 DUF3359: Protein of u 25.6 82 0.0018 19.3 2.4 15 1-15 1-15 (96)
61 PF00299 Squash: Squash family 25.1 11 0.00023 18.4 -1.3 24 29-52 2-26 (29)
62 COG2991 Uncharacterized protei 25.0 1.3E+02 0.0029 17.7 3.1 16 35-50 44-59 (77)
63 PF03207 OspD: Borrelia outer 24.8 77 0.0017 21.8 2.4 18 1-18 1-18 (254)
64 PRK15209 long polar fimbrial p 24.7 75 0.0016 20.4 2.3 10 1-10 1-10 (174)
65 PF12459 DUF3687: D-Ala-teicho 24.5 83 0.0018 16.5 2.0 7 6-12 15-21 (42)
66 PRK11267 biopolymer transport 24.4 61 0.0013 20.4 1.8 10 6-15 26-35 (141)
67 TIGR02209 ftsL_broad cell divi 23.6 96 0.0021 17.4 2.4 10 1-10 1-10 (85)
68 PF00029 Connexin: Connexin; 23.0 1.1E+02 0.0023 19.0 2.6 18 35-52 51-69 (107)
69 KOG1443 Predicted integral mem 22.8 58 0.0013 24.3 1.6 9 1-9 115-123 (349)
70 PRK15240 resistance to complem 22.6 79 0.0017 21.1 2.1 12 1-12 1-12 (185)
71 PF02553 CbiN: Cobalt transpor 22.5 80 0.0017 18.4 1.9 9 1-9 1-9 (74)
72 PRK11443 lipoprotein; Provisio 22.5 80 0.0017 20.0 2.0 6 1-6 1-6 (124)
73 PRK10780 periplasmic chaperone 22.5 93 0.002 20.1 2.4 12 1-12 1-12 (165)
74 TIGR02801 tolR TolR protein. T 22.2 90 0.0019 19.0 2.2 14 6-19 13-27 (129)
75 PF12276 DUF3617: Protein of u 22.1 88 0.0019 19.6 2.2 13 1-13 1-13 (162)
76 PF10855 DUF2648: Protein of u 22.0 38 0.00082 16.9 0.4 10 1-10 1-10 (33)
77 TIGR02804 ExbD_2 TonB system t 21.8 78 0.0017 19.3 1.9 13 6-18 12-25 (121)
78 PRK11024 colicin uptake protei 21.8 87 0.0019 19.6 2.1 13 6-18 23-36 (141)
79 PRK06667 motB flagellar motor 21.7 73 0.0016 22.0 1.9 12 7-18 30-41 (252)
80 PF06291 Lambda_Bor: Bor prote 21.7 88 0.0019 19.1 2.0 12 1-12 1-12 (97)
81 PF09403 FadA: Adhesion protei 21.3 31 0.00068 22.0 0.0 12 1-12 1-12 (126)
82 PHA02691 hypothetical protein; 20.9 1.2E+02 0.0025 19.2 2.5 16 1-16 1-16 (110)
83 PF11153 DUF2931: Protein of u 20.7 86 0.0019 21.0 2.0 8 1-8 1-8 (216)
84 PF12809 Metallothi_Euk2: Euka 20.3 47 0.001 19.6 0.6 33 40-72 17-49 (80)
85 cd00150 PlantTI Plant trypsin 20.3 24 0.00052 16.9 -0.5 17 35-51 7-23 (27)
86 TIGR00156 conserved hypothetic 20.1 92 0.002 19.9 2.0 10 1-10 1-10 (126)
No 1
>PF07333 SLR1-BP: S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP); InterPro: IPR010851 This entry consists of a number of cysteine rich SLR1 binding pollen coat like proteins. Adhesion of pollen grains to the stigmatic surface is a critical step during sexual reproduction in plants. In Brassica, S locus-related glycoprotein 1 (SLR1), a stigma-specific protein belonging to the S gene family of proteins, has been shown to be involved in this step. SLR1-BP specifically binds SLR1 with high affinity. The SLR1-BP gene is specifically expressed in pollen at late stages of development and is a member of the class A pollen coat protein (PCP) family, which includes PCP-A1, an SLG (S locus glycoprotein)-binding protein []. This entry also includes defensin-like proteins. The function of these proteins is uncharacterised.
Probab=99.08 E-value=1.3e-10 Score=65.00 Aligned_cols=44 Identities=36% Similarity=0.953 Sum_probs=37.9
Q ss_pred cccceee-----ecCCCcchHHHhhhhCCCc-cEeeccCCCCCCCceEEeecC
Q 046678 28 NTCEKFW-----ACNGDDQCKADCQKNYKGT-GWCDFHKAIPPEKYCFCQYNC 74 (74)
Q Consensus 28 ~~C~~~~-----~C~~~~~C~~~C~~~~~g~-G~C~~~~~~~~~~~C~C~y~C 74 (74)
++|++++ +|+. ++|++.|.++|+|. |+|. +.++.+.+|+|+|+|
T Consensus 9 ~~C~~~l~~~~~~C~~-~~C~~~C~~k~~g~~G~C~--~~~~~~~~C~C~Y~C 58 (58)
T PF07333_consen 9 RQCHEVLPNKPGPCDP-QDCRSLCKKKYKGGVGTCI--PKPKGPKQCLCTYNC 58 (58)
T ss_pred CcCceeCccCCCCCCh-HHHHHHHHHHcCCCceEec--cCCCCCCeeEEEeeC
Confidence 4499877 7999 99999999999987 9999 343458899999998
No 2
>PF00304 Gamma-thionin: Gamma-thionin family; InterPro: IPR008176 The following small plant proteins are evolutionary related: Gamma-thionins from Triticum aestivum (Wheat) endosperm (gamma-purothionins) and gamma-hordothionins from Hordeum vulgare(Barley) are toxic to animal cells and inhibit protein synthesis in cell free systems []. A flower-specific thionin (FST) from Nicotiana tabacum (Common Tobacco)[]. Antifungal proteins (AFP) from the seeds of Brassicaceae species such as radish, mustard, turnip and Arabidopsis thaliana (Thale Cress)[]. Inhibitors of insect alpha-amylases from sorghum []. Probable protease inhibitor P322 from Solanum tuberosum (Potato). A germination-related protein from Vigna unguiculata (Cowpea) []. Anther-specific protein SF18 from sunflower. SF18 is a protein that contains a gamma-thionin domain at its N terminus and a proline-rich C-terminal domain. Glycine max (Soybean) sulphur-rich protein SE60 []. Vicia faba (Broad bean) antibacterial peptides fabatin-1 and -2. In their mature form, these proteins generally consist of about 45 to 50 amino-acid residues. As shown in the following schematic representation, these peptides contain eight conserved cysteines involved in disulphide bonds. +-------------------------------------------+ | +-------------------+ | | | | | xxCxxxxxxxxxxCxxxxxCxxxCxxxxxxxxxCxxxxxxCxCxxxC | | | | +---|----------------+ | +------------------+ 'C': conserved cysteine involved in a disulphide bond. The folded structure of Gamma-purothionin is characterised by a well-defined 3-stranded anti-parallel beta-sheet and a short alpha-helix []. Three disulphide bridges are located in the hydrophobic core between the helix and sheet, forming a cysteine-stabilised alpha-helical motif. This structure differs from that of the plant alpha- and beta- thionins, but is analogous to scorpion toxins and insect defensins.; GO: 0006952 defense response; PDB: 4AB0_A 4AAZ_B 1N4N_A 2KPY_A 1JKZ_A 1AYJ_A 1GPT_A 1BK8_A 2GL1_A 1GPS_A ....
Probab=98.40 E-value=2.3e-07 Score=50.01 Aligned_cols=35 Identities=31% Similarity=0.775 Sum_probs=30.5
Q ss_pred ecCCCcchHHHhhhhCCCccEeeccCCCCCCCceEEeecC
Q 046678 35 ACNGDDQCKADCQKNYKGTGWCDFHKAIPPEKYCFCQYNC 74 (74)
Q Consensus 35 ~C~~~~~C~~~C~~~~~g~G~C~~~~~~~~~~~C~C~y~C 74 (74)
+|..+++|++.|++++...|.|. . ...+|+|+++|
T Consensus 13 ~C~~~~~C~~~C~~eg~~~G~C~--~---~~~~C~C~~~C 47 (47)
T PF00304_consen 13 LCFSDSNCANVCINEGFTGGKCS--G---PLRRCFCTKPC 47 (47)
T ss_dssp S-SSHHHHHHHHHHCTSSEEEEE--T---TTTEEEEEEEE
T ss_pred ECCCcchhhHHhccCCCCCCEeC--C---CCceEEEeCcC
Confidence 89988999999999998899999 2 36789999987
No 3
>PF10868 DUF2667: Protein of unknown function (DUF2667); InterPro: IPR022618 This family of proteins with unknown function appears to be restricted to Arabidopsis thaliana.
Probab=98.01 E-value=5e-06 Score=50.58 Aligned_cols=49 Identities=24% Similarity=0.601 Sum_probs=36.3
Q ss_pred cccc-ccceee-ecCC-CcchHHHhhhhCC--CccEeeccCCCCCCCceEEeec
Q 046678 25 AQAN-TCEKFW-ACNG-DDQCKADCQKNYK--GTGWCDFHKAIPPEKYCFCQYN 73 (74)
Q Consensus 25 ~ea~-~C~~~~-~C~~-~~~C~~~C~~~~~--g~G~C~~~~~~~~~~~C~C~y~ 73 (74)
++|+ .|...+ +|.. +.+|+..|++.++ ..|.|.+-+.++....|.|.|+
T Consensus 27 V~G~~~cd~~~G~C~~~~~~C~~~Ck~~~~~y~GG~C~~~~~~~~~~~C~Cc~~ 80 (90)
T PF10868_consen 27 VDGRLKCDSPFGACTPFSSDCNEPCKKFGSNYYGGQCVPVGPPPGDGVCYCCYY 80 (90)
T ss_pred eCCeEccCcccccCCchHHHHHHHHHhhccCCCCceeccCCCCCCCcEEEEecc
Confidence 6665 487767 9999 5999999998763 6899994233334677999875
No 4
>cd00107 Knot1 The "knottin" fold is stable cysteine-rich scaffold, in which one disulfide bridge crosses the macrocycle made by two other disulfide bridges and the connecting backbone segments. Members include plant lectins/antimicrobial peptides, plant proteinase/amylase inhibitors, plant gamma-thionins, and arthropod defensins.
Probab=97.07 E-value=0.00073 Score=33.58 Aligned_cols=32 Identities=28% Similarity=0.802 Sum_probs=25.0
Q ss_pred ecCCCcchHHHhhhhCCCccEeeccCCCCCCCceEEe
Q 046678 35 ACNGDDQCKADCQKNYKGTGWCDFHKAIPPEKYCFCQ 71 (74)
Q Consensus 35 ~C~~~~~C~~~C~~~~~g~G~C~~~~~~~~~~~C~C~ 71 (74)
.|..++.|++.|+++....|.|. . ..++|+|+
T Consensus 2 ~C~~~~~C~~~Ck~~g~~~G~C~--~---~~~~C~C~ 33 (33)
T cd00107 2 TCFSDSYCDKECKKKGASGGYCY--G---QGLACWCY 33 (33)
T ss_pred cCCCchhHHHHHhHcCCCccEeC--C---CCCeEEeC
Confidence 36677889999999866789998 2 24679985
No 5
>smart00505 Knot1 Knottins. Knottins, representing plant lectins/antimicrobial peptides, plant proteinase/amylase inhibitors, plant gamma-thionins and arthropod defensins.
Probab=96.11 E-value=0.0058 Score=31.81 Aligned_cols=33 Identities=27% Similarity=0.738 Sum_probs=25.8
Q ss_pred ecCCCc-chHHHhhhhCCCccEeeccCCCCCCCceEEee
Q 046678 35 ACNGDD-QCKADCQKNYKGTGWCDFHKAIPPEKYCFCQY 72 (74)
Q Consensus 35 ~C~~~~-~C~~~C~~~~~g~G~C~~~~~~~~~~~C~C~y 72 (74)
+|..+. +|++.|+++....|.|. . ...+|+|++
T Consensus 12 ~C~~~~~~C~~~C~~~g~~~G~C~--~---~~~~C~C~~ 45 (45)
T smart00505 12 NCKSSCALCAKLCKKKGAKGGYCR--G---TTRRCFCYK 45 (45)
T ss_pred CccCCchHhHHHhhhcCCCCCCcC--C---cCCceEeeC
Confidence 688756 89999999866689998 2 246799974
No 6
>PF00451 Toxin_2: Scorpion short toxin, BmKK2; InterPro: IPR001947 Scorpion venoms contain a variety of peptides toxic to mammals, insects and crustaceans. Among these peptides there is a family of short toxins (30 to 40 residues) [, ] including charybdotoxin, kaliotoxin [], noxiustoxin [] and iberiotoxin [, ]. Charybdotoxin consists of a single polypeptide chain and is a potent, selective inhibitor of calcium-activated potassium channels in pituitary and aortic smooth muscle cells - the toxin reversibly blocks channel activity by interacting at the external pore of the channel protein[]. The tertiary structure of the toxins comprises a 3-stranded beta-sheet and a short helix, and is stabilised by a number of disulphide bridges [] as shown in the following schematic representation: +---------------------+ | | | | xxxxxxxCxxxxxCxxxCxxxxxxxxxxxCxxxxCxCxxx | | | | | +----------------+ | +----------------------+ 'C': conserved cysteine involved in a disulphide bond. ; GO: 0008200 ion channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region; PDB: 1TSK_A 2PTA_A 1BIG_A 3ODV_A 2UVS_A 2KTX_A 1XSW_A 1KTX_A 1WMT_A 1PNH_A ....
Probab=93.97 E-value=0.071 Score=26.62 Aligned_cols=30 Identities=30% Similarity=0.711 Sum_probs=24.5
Q ss_pred ecCCCcchHHHhhhhCC-CccEeeccCCCCCCCceEEe
Q 046678 35 ACNGDDQCKADCQKNYK-GTGWCDFHKAIPPEKYCFCQ 71 (74)
Q Consensus 35 ~C~~~~~C~~~C~~~~~-g~G~C~~~~~~~~~~~C~C~ 71 (74)
.|..+.+|...|++..+ ..|.|. ...|.||
T Consensus 2 ~C~~s~~C~~~Ck~~~g~~~gKCm-------N~kC~Cy 32 (32)
T PF00451_consen 2 KCTGSKDCWPPCKKATGCLNGKCM-------NGKCKCY 32 (32)
T ss_dssp BTSSHHHHHHHHHHHTSSSEEEEE-------TTEEEEE
T ss_pred ccCCchHHHHHhhhhhCCCCCCcc-------CCCceeC
Confidence 36767899999999975 589999 5678886
No 7
>PF07127 Nodulin_late: Late nodulin protein; InterPro: IPR009810 This family consists of several plant specific late nodulin sequences which are homologous to the Pisum sativum (Garden pea) ENOD3 protein. ENOD3 is expressed in the late stages of root nodule formation and contains two pairs of cysteine residues toward the proteins C terminus which may be involved in metal-binding [].; GO: 0046872 metal ion binding, 0009878 nodule morphogenesis
Probab=93.80 E-value=0.059 Score=29.40 Aligned_cols=47 Identities=23% Similarity=0.350 Sum_probs=24.2
Q ss_pred CchHH-HHHHHHH-HHHHhcccccccccccccceeeecCCCcchHHHhhhhCCCccEee
Q 046678 1 MAKFT-IVCFLLA-FLLVSDGNMFLGAQANTCEKFWACNGDDQCKADCQKNYKGTGWCD 57 (74)
Q Consensus 1 M~k~s-~~~~lil-~~l~s~~~~~~~~ea~~C~~~~~C~~~~~C~~~C~~~~~g~G~C~ 57 (74)
||++. ++|++|+ +.||-+... ++ ...+|..+.+|...|... ..-.|.
T Consensus 1 Ma~ilKFvY~mIiflslflv~~~---~~-----~~~~C~~d~DCp~~c~~~--~~~kCi 49 (54)
T PF07127_consen 1 MAKILKFVYAMIIFLSLFLVVTN---VD-----AIIPCKTDSDCPKDCPPP--FIPKCI 49 (54)
T ss_pred CccchhhHHHHHHHHHHHHhhcc---cC-----CCcccCccccCCCCCCCC--cCcEeC
Confidence 88877 6677666 333333211 11 222677767776664322 344444
No 8
>PF11415 Toxin_37: Antifungal peptide termicin; InterPro: IPR024723 Termicin is a cysteine-rich antifungal peptide, which also exhibits weak antibacterial activity. The global fold of termicin consists of an alpha-helical segment and a two-stranded antiparallel beta-sheet forming a cysteine stabilised alphabeta motif that is also found in antibacterial and antifungal defensins from insects and from plants. The antifungal properties of termicin may be related to its marked hydrophobicity and its amphipatic structure compared to the antibacterial defensins [].; PDB: 1MM0_A.
Probab=91.80 E-value=0.14 Score=26.04 Aligned_cols=30 Identities=33% Similarity=0.862 Sum_probs=21.9
Q ss_pred cCCCcchHHHhhhhCC---CccEeeccCCCCCCCceEEeec
Q 046678 36 CNGDDQCKADCQKNYK---GTGWCDFHKAIPPEKYCFCQYN 73 (74)
Q Consensus 36 C~~~~~C~~~C~~~~~---g~G~C~~~~~~~~~~~C~C~y~ 73 (74)
|+. ++|.+.|+++|+ ...-|+ ...|.|.|+
T Consensus 1 C~~-~~CWa~CqaqhgiyFRRAyCd-------Gs~C~Cvf~ 33 (35)
T PF11415_consen 1 CDF-QSCWANCQAQHGIYFRRAYCD-------GSRCKCVFN 33 (35)
T ss_dssp --H-HHHHHHHHHHS-TTEEEEEEE-------TTEEEEEE-
T ss_pred CcH-HHHHHHHHHhhcchhhhhhcc-------CCeeEEEec
Confidence 455 789999999995 468899 567998874
No 9
>PF01097 Defensin_2: Arthropod defensin; InterPro: IPR001542 Arthropod defensins are a family of insect and scorpion cysteine-rich antibacterial peptides, primarily active against Gram-positive bacteria [, , , , ]. All these peptides range in length from 38 to 51 amino acids. There are six conserved cysteines all involved in intrachain disulphide bonds. A schematic representation of peptides from the arthropod defensin family is shown below. +----------------------------+ | | xxCxxxxxxxxxxxxxxCxxxCxxxxxxxxxCxxxxxCxCxx | | | | +---|---------------+ | +-----------------+ 'C': conserved cysteine involved in a disulphide bond. Although low level sequence similarities have been reported [] between the arthropod defensins and mammalian defensins, the topological arrangement of the disulphide bonds as well as the tertiary structure [] are completely different in the two families.; GO: 0006952 defense response; PDB: 1FJN_A 1ICA_A 1L4V_A 2LLD_A 3E7R_L 3E7U_X 1ZFU_A 2B68_A 2NZ3_A 2NY8_X ....
Probab=91.74 E-value=0.31 Score=24.59 Aligned_cols=27 Identities=26% Similarity=0.747 Sum_probs=22.8
Q ss_pred CcchHHHhhhhCCCccEeeccCCCCCCCceEEe
Q 046678 39 DDQCKADCQKNYKGTGWCDFHKAIPPEKYCFCQ 71 (74)
Q Consensus 39 ~~~C~~~C~~~~~g~G~C~~~~~~~~~~~C~C~ 71 (74)
+..|.+.|+......|.|. + ...|.|+
T Consensus 8 ~~~C~~hC~~~g~~GGyC~--~----~~vC~Cr 34 (34)
T PF01097_consen 8 HSACAAHCLSIGYRGGYCN--G----KGVCVCR 34 (34)
T ss_dssp CHHHHHHHHHHTCSEEEEE--T----TSCEEEE
T ss_pred HHHHHHHHHHhCCcceeCC--C----CCEEEeC
Confidence 4789999999988899999 2 5679885
No 10
>PF14865 Macin: Macin; PDB: 2K35_A 2LN8_A.
Probab=84.67 E-value=0.94 Score=25.56 Aligned_cols=18 Identities=22% Similarity=0.484 Sum_probs=14.3
Q ss_pred cchHHHhhhhCCCccEee
Q 046678 40 DQCKADCQKNYKGTGWCD 57 (74)
Q Consensus 40 ~~C~~~C~~~~~g~G~C~ 57 (74)
.+|+++|+-.....|.|.
T Consensus 22 ~sC~~~Ckc~G~~gG~C~ 39 (59)
T PF14865_consen 22 KSCNDRCKCLGHDGGECV 39 (59)
T ss_dssp -CCHHHHHTTT-SEEEEE
T ss_pred hHhhHHHHHcCCCCCceE
Confidence 579999997777899999
No 11
>PF00537 Toxin_3: Scorpion toxin-like domain ; InterPro: IPR002061 Scorpion toxins, which may be mammal or insect specific, bind to sodium channels, inhibiting the inactivation of activated channels and blocking neuronal transmission. The complete covalent structure of the toxins has been deduced: it comprises around 66 amino acid residues and is cross- linked by 4 disulphide bridges [, ]. An anti-epilepsy peptide isolated from scorpion venom [] shows similarity to both scorpion neurotoxins and anti-insect toxins. This family also contains a group of proteinase inhibitors from Arabidopsis thaliana and Brassica spp., which belong to MEROPS inhibitor family I18, clan I-. The Brassica napus (Oil seed rape) and Sinapis alba (White mustard) inhibitors [, ], inhibit the catalytic activity of bovine beta-trypsin and bovine alpha-chymotrypsin, which belong to MEROPS peptidase family S1 (IPR001254 from INTERPRO) [].; GO: 0008200 ion channel inhibitor activity, 0005576 extracellular region; PDB: 2LI7_A 2LJM_A 2B3C_A 1B3C_A 1WWN_A 1JZA_B 1JZB_A 4AEI_A 1AHO_A 1PTX_A ....
Probab=83.25 E-value=1.7 Score=23.81 Aligned_cols=36 Identities=22% Similarity=0.669 Sum_probs=24.8
Q ss_pred ecCCCcchHHHhhhhCCCccEeeccCCCCCCCceEEee
Q 046678 35 ACNGDDQCKADCQKNYKGTGWCDFHKAIPPEKYCFCQY 72 (74)
Q Consensus 35 ~C~~~~~C~~~C~~~~~g~G~C~~~~~~~~~~~C~C~y 72 (74)
.|..++-|+..|+++....|.|.. ..+ ....|.|..
T Consensus 14 ~C~~n~~C~~~Ck~~ga~~GyC~~-~~~-~g~aCwC~~ 49 (54)
T PF00537_consen 14 SCFPNEYCNKECKKKGAKSGYCYW-WGP-YGLACWCEG 49 (54)
T ss_dssp BSSSHHHHHHHHHHTTSSEEEEEC-TET-TEEEEEEEE
T ss_pred ECCCcchhhHHHHhcCCCccEeeC-CCC-CCCeEECCC
Confidence 466568999999995455899992 211 235699974
No 12
>PF08027 Albumin_I: Albumin I; InterPro: IPR012512 The albumin I protein, a hormone-like peptide, stimulates kinase activity upon binding a membrane bound 43 kDa receptor. The structure of this region reveals a knottin like fold, comprise of three beta strands [].; GO: 0045735 nutrient reservoir activity, 0009405 pathogenesis; PDB: 1P8B_A 1JU8_A.
Probab=74.07 E-value=1.1 Score=28.53 Aligned_cols=33 Identities=21% Similarity=0.548 Sum_probs=15.4
Q ss_pred cccccccccee-----e-ecCCCcchHHHhhhhCCCccEeec
Q 046678 23 LGAQANTCEKF-----W-ACNGDDQCKADCQKNYKGTGWCDF 58 (74)
Q Consensus 23 ~~~ea~~C~~~-----~-~C~~~~~C~~~C~~~~~g~G~C~~ 58 (74)
+++||..|... . +|.+ ++|+ |.-.+--.|.|..
T Consensus 15 kKVEA~~C~g~Cs~Fe~ppCgs-s~Cr--CiP~~l~~G~C~~ 53 (120)
T PF08027_consen 15 KKVEACDCSGVCSPFEMPPCGS-SDCR--CIPWGLFVGFCIY 53 (120)
T ss_dssp -------SECEE-TTSSSCCC--TTSE--EEE-SSS-EEEE-
T ss_pred eeeeeeccCccccCCcCCCCCC-CCee--EEEeeecceEEEC
Confidence 45787667642 1 7887 7787 7766656788983
No 13
>PF08119 Toxin_31: Scorpion acidic alpha-KTx toxin family; InterPro: IPR012635 This entry represents proteins that are acidic alpha-KTx short chain scorpion toxins. These toxins are named parabutoxins, that binds and inhibit voltage-sensitive potassium channels and inhibit the vertebrate potassium channel Kv1.1 with low affinity. Furthermore, they lack the crucial pore-plugging lysine. In addition, the second important residue of the dyad, the hydrophobic residue (Phe or Tyr) is also missing [].; GO: 0019870 potassium channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region
Probab=71.32 E-value=0.43 Score=24.01 Aligned_cols=26 Identities=31% Similarity=0.721 Sum_probs=18.9
Q ss_pred cchHHHhhhhCCCccEeeccCCCCCCCceEEe
Q 046678 40 DQCKADCQKNYKGTGWCDFHKAIPPEKYCFCQ 71 (74)
Q Consensus 40 ~~C~~~C~~~~~g~G~C~~~~~~~~~~~C~C~ 71 (74)
.-|.-.|+.++...|.|+ +++.|.|+
T Consensus 11 emcviyckgeeystgvcd------gpqkckcs 36 (37)
T PF08119_consen 11 EMCVIYCKGEEYSTGVCD------GPQKCKCS 36 (37)
T ss_pred ceEEEEecCceecccccc------CCcccccC
Confidence 456667777888899999 25667774
No 14
>PF06607 Prokineticin: Prokineticin; InterPro: IPR023569 The prokineticin family includes prokinectin itself and related proteins such as BM8 and the AVIToxins. The suprachiasmatic nucleus (SCN) controls the circadian rhythm of physiological and behavioural processes in mammals. It has been shown that prokineticin 2 (PK2), a cysteine-rich secreted protein, functions as an output molecule from the SCN circadian clock. PK2 messenger RNA is rhythmically expressed in the SCN, and the phase of PK2 rhythm is responsive to light entrainment. Molecular and genetic studies have revealed that PK2 is a gene that is controlled by a circadian clock []. The prokinectin domain is found in the prokinectin family and the hainantoxins, where it comprises the whole length of the protein. This domain is also found at the C terminus of some members of the Dickkopf family.; PDB: 1IMT_A 2KRA_A.
Probab=71.10 E-value=2.3 Score=26.13 Aligned_cols=10 Identities=30% Similarity=0.590 Sum_probs=4.2
Q ss_pred ccceeeecCC
Q 046678 29 TCEKFWACNG 38 (74)
Q Consensus 29 ~C~~~~~C~~ 38 (74)
.|++...|..
T Consensus 25 ~C~~d~dCg~ 34 (97)
T PF06607_consen 25 ACESDADCGP 34 (97)
T ss_dssp C-SSGGGT-T
T ss_pred cccCcCCCCC
Confidence 4665555554
No 15
>PF04202 Mfp-3: Foot protein 3; InterPro: IPR007328 Mytilus foot protein-3 (Mfp-3) is a highly polymorphic protein family located in the byssal adhesive plaques of blue mussels.
Probab=70.15 E-value=4.6 Score=23.44 Aligned_cols=15 Identities=27% Similarity=0.510 Sum_probs=9.2
Q ss_pred CchHHHHHHHHHHHH
Q 046678 1 MAKFTIVCFLLAFLL 15 (74)
Q Consensus 1 M~k~s~~~~lil~~l 15 (74)
|.++||..++.|+|+
T Consensus 1 mnn~Si~VLlaLvLI 15 (71)
T PF04202_consen 1 MNNLSIAVLLALVLI 15 (71)
T ss_pred CCchhHHHHHHHHHH
Confidence 788887555544333
No 16
>PF08086 Toxin_17: Ergtoxin family; InterPro: IPR012622 The Ergtoxin (ErgTx) family is a class of peptides from scorpion venom that specifically block ERG (ether-a-go-go-related gene) K+ channels of the nerve, heart and endocrine cells [, , ]. Peptides of the ErgTx family have from 42 to 47 amino acid residues cross-linked by four disulphide bridges. The four disulphide bridges have been assigned as C1-C4, C2-C6, C3-C7 and C5-C8 (see the schematic representation below) []. ErgTxs consist of a triple-stranded beta-sheet and an alpha-helix, as is typical of K+ channel scorpion toxins. There is a large hydrophobic patch on the surface of the toxin, surrounding a central lysine residue located near the beta-hairpin loop between the second and third strands of the beta-sheet. It has been postulated that this hydrophobic patch is likely to form part of the binding surface of the toxin []. Peptides of the ErgTx family possess a Knottin scaffold (see http://knottin.cbs.cnrs.fr). Some proteins known to belong to the ErgTx family are listed below: ErgTx1, ErgTx2 and ErgTx3 from Centruroides elegans (Bark scorpion). ErgTx1, ErgTx2, ErgTx3 and ErgTx4 from Centruroides exilicauda (Bark scorpion). ErgTx1, ErgTx2 and ErgTx3 from Centruroides gracilis (Slenderbrown scorpion) (Florida bark scorpion). ErgTx1, ErgTx2, ErgTx3 and ErgTx4 from Centruroides limpidus limpidus (Mexican scorpion). ErgTx1, ErgTx2, ErgTx3, ErgTx4, ErgTx5 and gamma-KTx 4.12 from Centruroides sculpturatus (Bark scorpion). ErgTx, ErgTx2, ErgTx3, ErgTx4 and ErgTx5 from Centruroides noxius (Mexican scorpion). ; GO: 0019870 potassium channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region; PDB: 1NE5_A 1PX9_A.
Probab=69.73 E-value=6.6 Score=20.33 Aligned_cols=18 Identities=33% Similarity=0.619 Sum_probs=15.0
Q ss_pred cchHHHhhhhCCCccEee
Q 046678 40 DQCKADCQKNYKGTGWCD 57 (74)
Q Consensus 40 ~~C~~~C~~~~~g~G~C~ 57 (74)
.+|+.-|++.....|+|+
T Consensus 18 ~qc~~cckkag~~~gtc~ 35 (41)
T PF08086_consen 18 GQCDDCCKKAGHRGGTCV 35 (41)
T ss_dssp HHHHHHHHHHTSS-EEEE
T ss_pred HHHHHHHHHhCCCCceeE
Confidence 578889998888889999
No 17
>PF02402 Lysis_col: Lysis protein; InterPro: IPR003059 The DNA sequence of the entire colicin E2 operon has been determined []. The operon comprises the colicin activity gene (ceaB), the colicin immunity gene (ceiB) and the lysis gene (celB), which is essential for colicin release from producing cells []. A putative LexA binding site is located upstream from ceaB, and a rho-independent terminator structure is located downstream from celB []. Comparison of the amino acid sequences of colicin E2 and cloacin DF13 reveal extensive similarity. These colicins have different modes of action and recognise different cell surface receptors; the two major regions of heterology at the C terminus, and in the C-terminal end of the central region are thought to correspond to the catalytic and receptor-recognition domains, respectively []. Sequence similarities between colicins E2, A and E1 [] are less striking. The colicin E2 (pyocin) immunity protein does not share similarity with either the colicin E3 or cloacin DF13 [] immunity proteins. By contrast, the lysis proteins of the ColE2, ColE1 and CloDF13 plasmids are almost identical except in the N-terminal regions, which themselves are similar to lipoprotein signal peptides []. Processing of the ColE2 prolysis protein to the mature form is prevented by globomycin, a specific inhibitor of the lipoprotein signal peptidase []. The mature ColE2 lysis protein is located in the cell envelope [].; GO: 0009405 pathogenesis, 0019835 cytolysis, 0019867 outer membrane
Probab=65.38 E-value=2.1 Score=22.96 Aligned_cols=15 Identities=33% Similarity=0.556 Sum_probs=8.8
Q ss_pred CchHHHHHHHHH-HHH
Q 046678 1 MAKFTIVCFLLA-FLL 15 (74)
Q Consensus 1 M~k~s~~~~lil-~~l 15 (74)
|+|+.++.++++ ++|
T Consensus 1 MkKi~~~~i~~~~~~L 16 (46)
T PF02402_consen 1 MKKIIFIGIFLLTMLL 16 (46)
T ss_pred CcEEEEeHHHHHHHHH
Confidence 888775555544 444
No 18
>PF08194 DIM: DIM protein; InterPro: IPR013172 Drosophila immune-induced molecules (DIMs) are short proteins induced during the immune response of Drosophila []. This entry includes DIMs 1 to 4 and DIM23.
Probab=64.38 E-value=7.1 Score=19.91 Aligned_cols=18 Identities=22% Similarity=0.314 Sum_probs=9.7
Q ss_pred CchHHHHHHHHHHHHHhc
Q 046678 1 MAKFTIVCFLLAFLLVSD 18 (74)
Q Consensus 1 M~k~s~~~~lil~~l~s~ 18 (74)
|+-+++.|+++++.++++
T Consensus 1 Mk~l~~a~~l~lLal~~a 18 (36)
T PF08194_consen 1 MKCLSLAFALLLLALAAA 18 (36)
T ss_pred CceeHHHHHHHHHHHHhc
Confidence 666776555544334443
No 19
>PF14866 Toxin_38: Potassium channel toxin
Probab=63.04 E-value=5.5 Score=22.25 Aligned_cols=26 Identities=31% Similarity=0.710 Sum_probs=20.1
Q ss_pred CcchHHHhhhhCCCccEeeccCCCCCCCceEEee
Q 046678 39 DDQCKADCQKNYKGTGWCDFHKAIPPEKYCFCQY 72 (74)
Q Consensus 39 ~~~C~~~C~~~~~g~G~C~~~~~~~~~~~C~C~y 72 (74)
+..|...|.+ .+..|.|+ ...|.|.-
T Consensus 29 ~~~Ce~HC~~-~~~~G~C~-------~~kCkC~~ 54 (56)
T PF14866_consen 29 EGWCEDHCQA-KKKEGKCH-------GTKCKCGK 54 (56)
T ss_pred HhHHHHHHHh-cCcCCeec-------CcccccCC
Confidence 4789999998 67799999 45577753
No 20
>PF06876 SCRL: Plant self-incompatibility response (SCRL) protein; InterPro: IPR010682 This family consists of several plant self-incompatibility response (SCRL) proteins. The male component of the self-incompatibility response in Brassica has been shown to be encoded by the S locus cysteine-rich gene (SCR). SCR is related, at the sequence level, to the pollen coat protein (PCP) gene family whose members encode small, cysteine-rich proteins located in the proteo-lipidic surface layer (tryphine) of Brassica pollen grains [].; GO: 0007165 signal transduction; PDB: 1UGL_A.
Probab=61.82 E-value=1.4 Score=24.56 Aligned_cols=42 Identities=21% Similarity=0.578 Sum_probs=11.7
Q ss_pred ccce--ee--ecCCCc--chHHHhhhhC-C--CccEeeccCCCCCCCceEEee
Q 046678 29 TCEK--FW--ACNGDD--QCKADCQKNY-K--GTGWCDFHKAIPPEKYCFCQY 72 (74)
Q Consensus 29 ~C~~--~~--~C~~~~--~C~~~C~~~~-~--g~G~C~~~~~~~~~~~C~C~y 72 (74)
.|.. .+ .|..+. .|...-.+.. + -.=+|. +.++..+.|.|.|
T Consensus 17 ~C~~~~~f~G~Cg~~G~~~C~~~~~~~~~~~p~~C~C~--~~~~~~r~C~C~~ 67 (67)
T PF06876_consen 17 RCPDKFNFPGKCGNSGNKTCEKDYKKGKKKKPSNCTCT--DSPKNGRLCDCKC 67 (67)
T ss_dssp --SSSS-EESSS-HHHHHHHHHH---------SS---B----SSSEEB--SS-
T ss_pred CCCCCceEcCcCCCCchhHHHHHhhhcccccCCcCEec--CCCCCCEEeeCcC
Confidence 4854 33 788533 3555544411 1 234465 3333344588865
No 21
>PF05294 Toxin_5: Scorpion short toxin; InterPro: IPR007958 This family contains various secreted scorpion short toxins which seem to be unrelated to those described in IPR001947 from INTERPRO.; GO: 0009405 pathogenesis, 0005576 extracellular region; PDB: 1SIS_A 1CHL_A.
Probab=59.81 E-value=16 Score=18.12 Aligned_cols=20 Identities=30% Similarity=0.810 Sum_probs=13.0
Q ss_pred HHhhhhCCCccEeeccCCCCCCCceEE
Q 046678 44 ADCQKNYKGTGWCDFHKAIPPEKYCFC 70 (74)
Q Consensus 44 ~~C~~~~~g~G~C~~~~~~~~~~~C~C 70 (74)
..|.+=-+|.|.|. .++|+|
T Consensus 13 ~kC~~CCgg~GkC~-------GpqClC 32 (32)
T PF05294_consen 13 KKCRDCCGGRGKCF-------GPQCLC 32 (32)
T ss_dssp HHHHHHCTTSEEEE-------TTEEEE
T ss_pred HHHHHHhCCCCeEc-------CCcccC
Confidence 34444445669999 567887
No 22
>PF03032 Brevenin: Brevenin/esculentin/gaegurin/rugosin family; InterPro: IPR004275 In addition to the highly specific cell-mediated immune system, vertebrates possess an efficient host-defence mechanism against invading microorganisms which involves the synthesis of highly potent antimicrobial peptides with a large spectrum of activity. This entry represents a number of these defence peptides secreted from the skin of amphibians, including the opiate-like dermorphins and deltorphins, and the antimicrobial dermoseptins and temporins.; GO: 0006952 defense response, 0042742 defense response to bacterium, 0005576 extracellular region
Probab=57.51 E-value=7.4 Score=20.77 Aligned_cols=17 Identities=24% Similarity=0.405 Sum_probs=8.2
Q ss_pred CchHHHHHHHHHHHHHh
Q 046678 1 MAKFTIVCFLLAFLLVS 17 (74)
Q Consensus 1 M~k~s~~~~lil~~l~s 17 (74)
|+|+.+++|++=++-+|
T Consensus 3 lKKsllLlfflG~ISlS 19 (46)
T PF03032_consen 3 LKKSLLLLFFLGTISLS 19 (46)
T ss_pred chHHHHHHHHHHHcccc
Confidence 67777544433333333
No 23
>PF12071 DUF3551: Protein of unknown function (DUF3551); InterPro: IPR021937 This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 79 to 104 amino acids in length. This protein has a single completely conserved residue C that may be functionally important.
Probab=51.10 E-value=49 Score=19.53 Aligned_cols=53 Identities=23% Similarity=0.365 Sum_probs=28.9
Q ss_pred CchHHHHHHHH--HHHHHhccccccccccc---ccceee------ecCCCcchHHHhhhhCCC-ccEee
Q 046678 1 MAKFTIVCFLL--AFLLVSDGNMFLGAQAN---TCEKFW------ACNGDDQCKADCQKNYKG-TGWCD 57 (74)
Q Consensus 1 M~k~s~~~~li--l~~l~s~~~~~~~~ea~---~C~~~~------~C~~~~~C~~~C~~~~~g-~G~C~ 57 (74)
|++.++..+.+ +++++.. ....++++ -|.+.. .|.. .=-++|+..-.| .+.|.
T Consensus 1 MR~~~~aa~a~~~~~~~~~~--~~~pA~A~dyp~Clq~~~~g~~g~C~y--~t~~QC~asASGr~a~C~ 65 (82)
T PF12071_consen 1 MRRLLLAALALLLAAALLAL--AAAPAQARDYPYCLQGGGWGYPGDCSY--STYEQCRASASGRGAYCG 65 (82)
T ss_pred ChhHHHHHHHHHHHHHHHhc--cccchhhcCCcEEEeCCCCCCCccCCc--CCHHHHHHHhcccCcccc
Confidence 77766543332 2222222 22334444 387633 4654 226889888877 68998
No 24
>PF13956 Ibs_toxin: Toxin Ibs, type I toxin-antitoxin system
Probab=50.81 E-value=7.7 Score=17.02 Aligned_cols=7 Identities=43% Similarity=0.757 Sum_probs=3.3
Q ss_pred CchHHHH
Q 046678 1 MAKFTIV 7 (74)
Q Consensus 1 M~k~s~~ 7 (74)
|-|..|+
T Consensus 1 MMk~vII 7 (19)
T PF13956_consen 1 MMKLVII 7 (19)
T ss_pred CceehHH
Confidence 4455543
No 25
>PF15284 PAGK: Phage-encoded virulence factor
Probab=49.64 E-value=22 Score=20.16 Aligned_cols=12 Identities=33% Similarity=0.545 Sum_probs=5.8
Q ss_pred CchHHHHHHHHH
Q 046678 1 MAKFTIVCFLLA 12 (74)
Q Consensus 1 M~k~s~~~~lil 12 (74)
|+|+=-+|+.++
T Consensus 1 Mkk~ksifL~l~ 12 (61)
T PF15284_consen 1 MKKFKSIFLALV 12 (61)
T ss_pred ChHHHHHHHHHH
Confidence 776543344333
No 26
>PF09889 DUF2116: Uncharacterized protein containing a Zn-ribbon (DUF2116); InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=46.40 E-value=18 Score=20.24 Aligned_cols=11 Identities=18% Similarity=0.156 Sum_probs=5.1
Q ss_pred chHHHHHHHHH
Q 046678 2 AKFTIVCFLLA 12 (74)
Q Consensus 2 ~k~s~~~~lil 12 (74)
+|+..++++++
T Consensus 36 ~~~~~i~~~~~ 46 (59)
T PF09889_consen 36 RKTQYIFFGIF 46 (59)
T ss_pred HHHHHHHHHHH
Confidence 44554444433
No 27
>TIGR02052 MerP mercuric transport protein periplasmic component. This model represents the periplasmic mercury (II) binding protein of the bacterial mercury detoxification system which passes mercuric ion to the MerT transporter for subsequent reduction to Hg(0) by the mercuric reductase MerA. MerP contains a distinctive GMTCXXC motif associated with metal binding. MerP is related to a larger family of metal binding proteins (pfam00403).
Probab=46.15 E-value=17 Score=19.58 Aligned_cols=10 Identities=30% Similarity=0.371 Sum_probs=6.2
Q ss_pred CchHHHHHHH
Q 046678 1 MAKFTIVCFL 10 (74)
Q Consensus 1 M~k~s~~~~l 10 (74)
|+|+..+|+|
T Consensus 1 ~~~~~~~~~~ 10 (92)
T TIGR02052 1 MKKLATLLAL 10 (92)
T ss_pred ChhHHHHHHH
Confidence 8887754443
No 28
>PF10690 Myticin-prepro: Myticin pre-proprotein from the mussel; InterPro: IPR019631 Myticin is a cysteine-rich peptide produced in three isoforms, A, B and C, by Mytilus galloprovincialis (Mediterranean mussel). Isoforms A and B show antibacterial activity against Gram-positive bacteria, while isoform B is additionally active against the fungus Fusarium oxysporum and a Gram-negative bacterium, Escherichia coli (streptomycin resistant strain D31) []. Myticin-prepro is the precursor peptide. The mature molecule, named myticin, consists of 40 residues, with four intramolecular disulphide bridges and a cysteine array in the primary structure different from that of previously characterised cysteine-rich antimicrobial peptides. The first 20 amino acids are a putative signal peptide, and the antimicrobial peptide sequence is a 36-residue C-terminal extension. Such a structure suggests that myticins are synthesised as prepro-proteins that are then processed by various proteolytic events before storage in the haemocytes as the active peptide. Myticin precursors are expressed mainly in the haemocytes. ; PDB: 2EEM_A.
Probab=45.90 E-value=14 Score=22.73 Aligned_cols=22 Identities=23% Similarity=0.369 Sum_probs=11.4
Q ss_pred ecCCCcchHHHhhhhCCCccEee
Q 046678 35 ACNGDDQCKADCQKNYKGTGWCD 57 (74)
Q Consensus 35 ~C~~~~~C~~~C~~~~~g~G~C~ 57 (74)
+|.+ .-|+..|.+..=+.-.|.
T Consensus 24 ~CtS-~yC~~fCgsa~C~~Y~c~ 45 (98)
T PF10690_consen 24 SCTS-YYCKKFCGSARCSLYGCY 45 (98)
T ss_dssp -HHH-H-HHHHHHHTT-SEEEEE
T ss_pred ccch-hHHHHhcCCCCCcEEEEE
Confidence 3443 347777877764444455
No 29
>COG5341 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=45.24 E-value=19 Score=23.31 Aligned_cols=18 Identities=28% Similarity=0.264 Sum_probs=7.8
Q ss_pred HHHHHHHHHHhccccccc
Q 046678 7 VCFLLAFLLVSDGNMFLG 24 (74)
Q Consensus 7 ~~~lil~~l~s~~~~~~~ 24 (74)
+++++++++|+.+...+.
T Consensus 21 I~sf~~i~~f~~a~~~kG 38 (132)
T COG5341 21 ILSFLPILLFSLAKAKKG 38 (132)
T ss_pred HHHHHHHHhheeeeccCC
Confidence 333333445555444443
No 30
>PRK09810 entericidin A; Provisional
Probab=43.06 E-value=29 Score=18.08 Aligned_cols=6 Identities=17% Similarity=0.617 Sum_probs=3.1
Q ss_pred CchHHH
Q 046678 1 MAKFTI 6 (74)
Q Consensus 1 M~k~s~ 6 (74)
|+|+.+
T Consensus 2 Mkk~~~ 7 (41)
T PRK09810 2 MKRLIV 7 (41)
T ss_pred hHHHHH
Confidence 555444
No 31
>PHA03399 pif3 per os infectivity factor 3; Provisional
Probab=42.36 E-value=25 Score=24.23 Aligned_cols=28 Identities=32% Similarity=0.877 Sum_probs=20.9
Q ss_pred cceee-ecCCCcchHHHhhhhC-CC-----ccEee
Q 046678 30 CEKFW-ACNGDDQCKADCQKNY-KG-----TGWCD 57 (74)
Q Consensus 30 C~~~~-~C~~~~~C~~~C~~~~-~g-----~G~C~ 57 (74)
|++.- +|..++||...|...- .| .|-|.
T Consensus 53 C~~t~lPCVtD~QC~dnC~~~~~~~~~~C~~GFC~ 87 (200)
T PHA03399 53 CSLTRLPCVTDQQCRDNCAIGSAAGVMTCDGGFCS 87 (200)
T ss_pred CcCCcCCcccHHHHHHHHHhccccceEECCCCeec
Confidence 77655 9999999999998543 22 36676
No 32
>PF11777 DUF3316: Protein of unknown function (DUF3316); InterPro: IPR016879 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=41.29 E-value=30 Score=21.18 Aligned_cols=12 Identities=33% Similarity=0.462 Sum_probs=7.6
Q ss_pred CchHHHHHHHHH
Q 046678 1 MAKFTIVCFLLA 12 (74)
Q Consensus 1 M~k~s~~~~lil 12 (74)
|+|+.+++++++
T Consensus 1 MKk~~ll~~~ll 12 (114)
T PF11777_consen 1 MKKIILLASLLL 12 (114)
T ss_pred CchHHHHHHHHH
Confidence 888876554433
No 33
>PF12393 Dr_adhesin: Dr family adhesin ; InterPro: IPR021020 The Dr family of adhesins bind to the Dr blood group antigen component of decay-accelerating factor. These proteins contain both fimbriated and afimbriated adherence structures and mediate adherence of uropathogenic Escherichia coli to the urinary tract []. They also confer the mannose-resistant hemagglutination phenotype, which can be inhibited by chloramphenicol. The N-terminal portion of the mature protein is thought to be responsible for chloramphenicol sensitivity []. This entry represents the signal peptide region necessary for protein secretion to the cell surface.
Probab=39.54 E-value=41 Score=15.14 Aligned_cols=12 Identities=25% Similarity=0.265 Sum_probs=8.4
Q ss_pred CchHHHHHHHHH
Q 046678 1 MAKFTIVCFLLA 12 (74)
Q Consensus 1 M~k~s~~~~lil 12 (74)
|+|..|......
T Consensus 1 MKklaiMaa~s~ 12 (21)
T PF12393_consen 1 MKKLAIMAAASM 12 (21)
T ss_pred CchHHHHHHHHH
Confidence 888887666544
No 34
>PRK11029 FtsH protease regulator HflC; Provisional
Probab=39.30 E-value=30 Score=25.33 Aligned_cols=23 Identities=17% Similarity=0.160 Sum_probs=13.1
Q ss_pred CchHHHHHHHHH-HHHHhcccccc
Q 046678 1 MAKFTIVCFLLA-FLLVSDGNMFL 23 (74)
Q Consensus 1 M~k~s~~~~lil-~~l~s~~~~~~ 23 (74)
|.++.+++++++ ++|++++-.+.
T Consensus 1 ~~~~~~~~~~~~~~~l~~s~~iV~ 24 (334)
T PRK11029 1 MRKSVIAIIIIVLVVLYMSVFVVK 24 (334)
T ss_pred CchHHHHHHHHHHHHHHheEEEEC
Confidence 888776555554 45555543433
No 35
>PF12099 DUF3575: Protein of unknown function (DUF3575); InterPro: IPR021958 This family of proteins are functionally uncharacterised. This family is only found in bacteria. Proteins in this family are typically between 187 to 236 amino acids in length.
Probab=39.08 E-value=23 Score=23.73 Aligned_cols=14 Identities=36% Similarity=0.612 Sum_probs=9.1
Q ss_pred CchHHHHHHHHHHH
Q 046678 1 MAKFTIVCFLLAFL 14 (74)
Q Consensus 1 M~k~s~~~~lil~~ 14 (74)
|+|+.+++++++++
T Consensus 1 ~~~~~~~~~~~~~~ 14 (189)
T PF12099_consen 1 MKKIRILFLLLLLF 14 (189)
T ss_pred CceehHHHHHHHHH
Confidence 88888666555533
No 36
>PRK09838 periplasmic copper-binding protein; Provisional
Probab=37.10 E-value=37 Score=21.24 Aligned_cols=18 Identities=22% Similarity=0.211 Sum_probs=10.8
Q ss_pred CchHHHHHHHHHHHHHhc
Q 046678 1 MAKFTIVCFLLAFLLVSD 18 (74)
Q Consensus 1 M~k~s~~~~lil~~l~s~ 18 (74)
|+|+.+..++.++++++.
T Consensus 1 mk~~~~~~~~~~~~~~~~ 18 (115)
T PRK09838 1 MKKALKVAMFSLFSVIGF 18 (115)
T ss_pred CchHHHHHHHHHHHHHhh
Confidence 788776555555544444
No 37
>PF00066 Notch: LNR domain; InterPro: IPR000800 The Notch domain is also called the 'DSL' domain or the Lin-12/Notch repeat (LNR). The LNR region is present only in Notch related proteins C-terminal to EGF repeats. The lin-12/Notch proteins act as transmembrane receptors for intercellular signals that specify cell fates during animal development. In response to a ligand, proteolytic cleavages release the intracellular domain of Notch, which then gains access to the nucleus and acts as a transcriptional co-activator []. The LNR region is supposed to negatively regulate the Lin-12/Notch proteins activity. It is a triplication of an around 35-40 amino acids module present on the extracellular part of the protein [, ]. Each module contains six cysteine residues engaged in three disulphide bonds and three conserved aspartate and asparagine residues []. The biochemical characterisation of a recombinantly expressed LIN-12.1 module from the human Notch1 receptor indicate that the disulphide bonds are formed between the first and fifth, second and fourth, and third and sixth cysteines. The formation of this particular disulphide isomer is favored by the presence of Ca2+, which is also required to maintain the structural integrity of the rLIN-12.1 module. The conserved aspartate and asparagine residues are likely to be important for Ca2+ binding, and thereby contribute to the native fold.; GO: 0030154 cell differentiation, 0016020 membrane; PDB: 3ETO_A 3I08_A 1PB5_A 3L95_X 2OO4_A.
Probab=36.74 E-value=13 Score=18.87 Aligned_cols=17 Identities=35% Similarity=1.005 Sum_probs=11.7
Q ss_pred cchH--HHhhhhCCCccEee
Q 046678 40 DQCK--ADCQKNYKGTGWCD 57 (74)
Q Consensus 40 ~~C~--~~C~~~~~g~G~C~ 57 (74)
.+|. ..|..++ |.|.|+
T Consensus 4 ~~C~~~~~C~~~~-gng~CD 22 (38)
T PF00066_consen 4 PKCPYSPYCWSKF-GNGVCD 22 (38)
T ss_dssp TTSCTSHHHHHHT-TSSS--
T ss_pred ccCcCCcCchhhc-CCCccC
Confidence 4566 8888888 888888
No 38
>PHA02291 hypothetical protein
Probab=34.95 E-value=32 Score=21.90 Aligned_cols=13 Identities=31% Similarity=0.506 Sum_probs=7.5
Q ss_pred hHHHHHHHHHHHH
Q 046678 3 KFTIVCFLLAFLL 15 (74)
Q Consensus 3 k~s~~~~lil~~l 15 (74)
|-+|.++|++.+|
T Consensus 4 K~~iFYiL~~~VL 16 (132)
T PHA02291 4 KASIFYILVVIVL 16 (132)
T ss_pred chhhHHHHHHHHH
Confidence 5566667666333
No 39
>PF12606 RELT: Tumour necrosis factor receptor superfamily member 19; InterPro: IPR022248 The members of tumor necrosis factor receptor (TNFR) superfamily have been designated as the "guardians of the immune system" due to their roles in immune cell proliferation, differentiation, activation, and death (apoptosis). RELT (receptor expressed in lymphoid tissues) is a member of the TNFR superfamily. The messenger RNA of RELT is especially abundant in hematologic tissues such as spleen, lymph node, and peripheral blood leukocytes as well as in leukemias and lymphomas. RELT is able to activate the NF-kappaB pathway and selectively binds tumor necrosis factor receptor-associated factor 1 []. RELT like proteins 1 and 2 (RELL1 and RELL2) are two RELT homologues that bind to RELT. The expression of RELL1 at the mRNA level is ubiquitous, whereas expression of RELL2 mRNA is more restricted to particular tissues [].
Probab=32.90 E-value=39 Score=18.27 Aligned_cols=9 Identities=11% Similarity=-0.156 Sum_probs=4.7
Q ss_pred cccccccce
Q 046678 24 GAQANTCEK 32 (74)
Q Consensus 24 ~~ea~~C~~ 32 (74)
++.+-+|+.
T Consensus 25 K~ygYkht~ 33 (50)
T PF12606_consen 25 KAYGYKHTV 33 (50)
T ss_pred hcccccccc
Confidence 445555653
No 40
>smart00286 PTI Plant trypsin inhibitors.
Probab=32.52 E-value=10 Score=18.39 Aligned_cols=24 Identities=29% Similarity=0.764 Sum_probs=16.7
Q ss_pred ccceee-ecCCCcchHHHhhhhCCC
Q 046678 29 TCEKFW-ACNGDDQCKADCQKNYKG 52 (74)
Q Consensus 29 ~C~~~~-~C~~~~~C~~~C~~~~~g 52 (74)
.|-.+| .|..|++|-..|.-..+|
T Consensus 2 ~CPrIlm~Ck~DsDCl~~CiC~~~G 26 (29)
T smart00286 2 ICPRILMECKRDSDCMAECICLANG 26 (29)
T ss_pred CCchhhhccccccCcccCCEEcccc
Confidence 355666 788888888888755544
No 41
>PF11587 Prion_bPrPp: Major prion protein bPrPp - N terminal; PDB: 1SKH_A.
Probab=31.97 E-value=15 Score=17.92 Aligned_cols=10 Identities=30% Similarity=0.730 Sum_probs=3.7
Q ss_pred CchHHHHHHH
Q 046678 1 MAKFTIVCFL 10 (74)
Q Consensus 1 M~k~s~~~~l 10 (74)
|+|+.+..-+
T Consensus 1 M~k~~lgcWi 10 (29)
T PF11587_consen 1 MVKSHLGCWI 10 (29)
T ss_dssp --TTTTTTHH
T ss_pred CccccccHHH
Confidence 6775543333
No 42
>PF11714 Inhibitor_I53: Thrombin inhibitor Madanin ; InterPro: IPR021716 Members of this family are the peptidase inhibitor madanin proteins. These proteins were isolated from tick saliva [].
Probab=30.68 E-value=38 Score=19.84 Aligned_cols=6 Identities=50% Similarity=0.894 Sum_probs=4.3
Q ss_pred CchHHH
Q 046678 1 MAKFTI 6 (74)
Q Consensus 1 M~k~s~ 6 (74)
|+++.|
T Consensus 1 MKhFai 6 (78)
T PF11714_consen 1 MKHFAI 6 (78)
T ss_pred CchHHH
Confidence 777775
No 43
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins. The list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied. The functional significance of EGF domains in what appear to be unrelated proteins is not yet clear. However, a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase). The EGF domain includes six cysteine residues which have been shown (in EGF) to be involved in disulphide bonds. The main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet. Subdomains between the conserved cysteines vary in length.; GO: 0005515 protein binding; PDB: 1WHE_A 1CCF_A 1APO_A 1WHF_A 2VJ3_A 1TOZ_A 4D90_B 3CFW_A 1EDM_B 1IXA_A ....
Probab=30.50 E-value=30 Score=16.38 Aligned_cols=18 Identities=22% Similarity=0.329 Sum_probs=12.1
Q ss_pred CccEeeccCCCCCCCceEEe
Q 046678 52 GTGWCDFHKAIPPEKYCFCQ 71 (74)
Q Consensus 52 g~G~C~~~~~~~~~~~C~C~ 71 (74)
..|+|. ..+...+.|.|.
T Consensus 8 n~g~C~--~~~~~~y~C~C~ 25 (32)
T PF00008_consen 8 NGGTCI--DLPGGGYTCECP 25 (32)
T ss_dssp TTEEEE--EESTSEEEEEEB
T ss_pred CCeEEE--eCCCCCEEeECC
Confidence 458898 443347788885
No 44
>TIGR01932 hflC HflC protein. HflK and HflC are paralogs encoded by tandem genes in Proteobacteria, spirochetes, and some other bacterial lineages. The HflKC complex is anchored in the membrane and exposed to the periplasm. The complex is not active as a protease, but rather binds to and appears to modulate the ATP-dependent protease FtsH. The overall function of HflKC is not fully described.//Regulation of FtsH protease appears to be negative (PubMed:8947034, PubMed:96367)
Probab=30.06 E-value=52 Score=23.55 Aligned_cols=26 Identities=23% Similarity=0.255 Sum_probs=14.0
Q ss_pred CchHHHHHHHHH-HHHHhccccccccc
Q 046678 1 MAKFTIVCFLLA-FLLVSDGNMFLGAQ 26 (74)
Q Consensus 1 M~k~s~~~~lil-~~l~s~~~~~~~~e 26 (74)
|.+..++.++++ +++++.+-.+..++
T Consensus 1 ~~~~~~~~~~~~~~~l~~~~~iV~~ge 27 (317)
T TIGR01932 1 MRKIGIVVIVLLIVVLFQPFFIIKEGE 27 (317)
T ss_pred CchHHHHHHHHHHHHHHheEEEECCCe
Confidence 787765444443 55555554444443
No 45
>PF07437 YfaZ: YfaZ precursor; InterPro: IPR009998 This family contains the precursor of the bacterial protein YfaZ (approximately 180 residues long). Many members of this family are hypothetical proteins.
Probab=29.78 E-value=54 Score=21.89 Aligned_cols=15 Identities=27% Similarity=0.394 Sum_probs=9.5
Q ss_pred CchHHHHHHHHHHHH
Q 046678 1 MAKFTIVCFLLAFLL 15 (74)
Q Consensus 1 M~k~s~~~~lil~~l 15 (74)
|+|+.+..++.++++
T Consensus 1 m~k~~~a~~~~l~~~ 15 (180)
T PF07437_consen 1 MKKFLLASAAALLLV 15 (180)
T ss_pred CchHHHHHHHHHHHH
Confidence 999987555444333
No 46
>KOG3384 consensus Selenoprotein [General function prediction only]
Probab=29.44 E-value=29 Score=22.96 Aligned_cols=32 Identities=31% Similarity=0.457 Sum_probs=16.3
Q ss_pred CchHHHHHHHHHHHHHhcccccccccccccce
Q 046678 1 MAKFTIVCFLLAFLLVSDGNMFLGAQANTCEK 32 (74)
Q Consensus 1 M~k~s~~~~lil~~l~s~~~~~~~~ea~~C~~ 32 (74)
|+|.-.++++++++|.+........+-+.|+.
T Consensus 1 ~~~m~vl~~ll~~vl~~~~~~~ee~s~eeC~~ 32 (154)
T KOG3384|consen 1 MAKMVVLSLLLALVLASTISAKEELSTEECED 32 (154)
T ss_pred CchHHHHHHHHHHHHHHHHHHHHHhhHHHHHH
Confidence 67766555555555655533332222234764
No 47
>PF09253 Ole-e-6: Pollen allergen ole e 6; InterPro: IPR015333 This entry represents pollen allergens, such as ole-e-6, a small acidic protein from Olea europaea (Common olive) which mediates olive allergy. Members of this family have an alpha-helical hairpin structure cross-linked by three disulphides, followed by a long, unstructured C-terminal tail [].; PDB: 1SS3_A.
Probab=29.38 E-value=14 Score=19.34 Aligned_cols=17 Identities=24% Similarity=0.929 Sum_probs=10.9
Q ss_pred cchHHHhhhhCCCccEe
Q 046678 40 DQCKADCQKNYKGTGWC 56 (74)
Q Consensus 40 ~~C~~~C~~~~~g~G~C 56 (74)
++|...|+++++|...|
T Consensus 3 n~C~keC~~~g~G~tfC 19 (41)
T PF09253_consen 3 NNCEKECKSEGNGYTFC 19 (41)
T ss_dssp HHHHHHHHTTT--HHHH
T ss_pred chHHHHHhccCCCeeeE
Confidence 46888888888776444
No 48
>PF03058 Sar8_2: Sar8.2 family; InterPro: IPR004297 Members of this family are found in Solanaceae spp. plants, a taxonomic group (family) that includes pepper and tobacco plant species. Synthesis of these proteins is induced by Tobacco mosaic virus and salicylic acid []; indeed they are thought to be involved in the development of systemic acquired resistance (SAR) after an initial hypersensitive response to microbial infection [, ]. SAR is characterised by long-lasting resistance to infection by a wide range of pathogens, extending to plant tissues distant from the initial infection site [].
Probab=29.07 E-value=41 Score=20.55 Aligned_cols=15 Identities=13% Similarity=0.069 Sum_probs=6.3
Q ss_pred HHHHhcccccccccc
Q 046678 13 FLLVSDGNMFLGAQA 27 (74)
Q Consensus 13 ~~l~s~~~~~~~~ea 27 (74)
|+++|.+..-+++||
T Consensus 18 mIISSqv~AREms~A 32 (93)
T PF03058_consen 18 MIISSQVDAREMSKA 32 (93)
T ss_pred HHHhhHHHHHHHhcc
Confidence 555554333333443
No 49
>PF11466 Doppel: Prion-like protein Doppel; InterPro: IPR021566 Dpl is a homologue related to the prion protein (PrP). Dpl is toxic to neurons and is expressed in the brains of mice that do not express PrP. In DHPC and SDS micelles, Dpl shoes about 40% alpha-helical structure however in aqueous solution it consists of a random coil. The alpha helical segment can adopt a transmembrane localisation also in a membrane. The unprocessed Dpl protein is thought to posses a possible channel formation mechanism which may be related to toxicity through direct interaction with cell membranes and damage to the cell membrane. ; PDB: 1Z65_A.
Probab=28.57 E-value=36 Score=16.63 Aligned_cols=9 Identities=33% Similarity=0.220 Sum_probs=4.9
Q ss_pred HHHHhcccc
Q 046678 13 FLLVSDGNM 21 (74)
Q Consensus 13 ~~l~s~~~~ 21 (74)
++|||..+.
T Consensus 15 ~LL~s~Ls~ 23 (30)
T PF11466_consen 15 VLLFSHLSS 23 (30)
T ss_dssp HHHHHHTTT
T ss_pred HHHHHHhhH
Confidence 556666444
No 50
>TIGR01655 yxeA_fam conserved hypothetical protein TIGR01655. This model represents a family of small (about 115 amino acids) uncharacterized proteins with N-terminal signal sequences, found exclusively in Gram-positive organisms. Most genomes that have any members of this family have at least two members.
Probab=28.31 E-value=46 Score=20.52 Aligned_cols=8 Identities=25% Similarity=0.060 Sum_probs=5.0
Q ss_pred CchHHHHH
Q 046678 1 MAKFTIVC 8 (74)
Q Consensus 1 M~k~s~~~ 8 (74)
|+|..+..
T Consensus 1 mKK~li~l 8 (114)
T TIGR01655 1 MKKGLAIL 8 (114)
T ss_pred CceehHHH
Confidence 78866443
No 51
>PF05540 Serpulina_VSP: Serpulina hyodysenteriae variable surface protein; InterPro: IPR008838 This family consists of several variable surface proteins from Treponema hyodysenteriae (Serpulina hyodysenteriae).
Probab=28.21 E-value=49 Score=24.95 Aligned_cols=21 Identities=24% Similarity=0.135 Sum_probs=14.5
Q ss_pred CchHHHHHHHHH-HHHHhcccc
Q 046678 1 MAKFTIVCFLLA-FLLVSDGNM 21 (74)
Q Consensus 1 M~k~s~~~~lil-~~l~s~~~~ 21 (74)
|+|+.+..+.++ +.-.|+|+|
T Consensus 1 MKK~lLt~~alltia~~SvFGm 22 (377)
T PF05540_consen 1 MKKVLLTAIALLTIASASVFGM 22 (377)
T ss_pred CcchHHHHHHHHHHHhhhhhee
Confidence 899887666655 555677654
No 52
>PF13985 YbgS: YbgS-like protein
Probab=28.09 E-value=63 Score=20.66 Aligned_cols=17 Identities=24% Similarity=0.358 Sum_probs=11.7
Q ss_pred CchHHHHHHHHHHHHHh
Q 046678 1 MAKFTIVCFLLAFLLVS 17 (74)
Q Consensus 1 M~k~s~~~~lil~~l~s 17 (74)
|.|+.++||-..|-|.|
T Consensus 1 M~Klatl~LTAtl~LaS 17 (122)
T PF13985_consen 1 MTKLATLFLTATLTLAS 17 (122)
T ss_pred CchHHHHHHHHHHHhhh
Confidence 88999876655565544
No 53
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones]
Probab=27.70 E-value=58 Score=22.11 Aligned_cols=12 Identities=8% Similarity=0.454 Sum_probs=5.7
Q ss_pred CchHHHHHHHHH
Q 046678 1 MAKFTIVCFLLA 12 (74)
Q Consensus 1 M~k~s~~~~lil 12 (74)
|.+..++++|++
T Consensus 1 ~mRvl~i~Llii 12 (182)
T COG2143 1 VMRVLLIVLLII 12 (182)
T ss_pred CcchHHHHHHHH
Confidence 334444455555
No 54
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins. The list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied. The functional significance of EGF domains in what appear to be unrelated proteins is not yet clear. However, a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase). The EGF domain includes six cysteine residues which have been shown (in EGF) to be involved in disulphide bonds. The main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet. Subdomains between the conserved cysteines vary in length. This entry contains EGF domains found in a variety of extracellular and membrane proteins
Probab=27.57 E-value=50 Score=15.92 Aligned_cols=16 Identities=38% Similarity=0.854 Sum_probs=10.2
Q ss_pred CCccEeeccCCCCCCCceEEe
Q 046678 51 KGTGWCDFHKAIPPEKYCFCQ 71 (74)
Q Consensus 51 ~g~G~C~~~~~~~~~~~C~C~ 71 (74)
+++|+|+. ...+|.|.
T Consensus 9 ~~~G~C~~-----~~g~C~C~ 24 (32)
T PF07974_consen 9 SGHGTCVS-----PCGRCVCD 24 (32)
T ss_pred CCCCEEeC-----CCCEEECC
Confidence 47888881 13567774
No 55
>PF10917 DUF2708: Protein of unknown function (DUF2708); InterPro: IPR024415 This entry represents fungus-induced proteins which may have role in hypoxia response[].
Probab=26.59 E-value=24 Score=18.63 Aligned_cols=7 Identities=14% Similarity=0.615 Sum_probs=4.1
Q ss_pred ccccccc
Q 046678 25 AQANTCE 31 (74)
Q Consensus 25 ~ea~~C~ 31 (74)
+.+++|+
T Consensus 19 ~~G~rC~ 25 (43)
T PF10917_consen 19 GGGHRCR 25 (43)
T ss_pred ccccccC
Confidence 4456676
No 56
>TIGR03656 IsdC heme uptake protein IsdC. Isd proteins are iron-regulated surface proteins found in Bacillus, Staphylococcus and Listeria species and are responsible for heme scavenging from hemoproteins. The IsdC protein consists of an N-terminal hydrophobic signal sequence, a central NEAT (NEAr Transporter, pfam05031) domain which confers the ability to bind heme and a C-terminal SrtB processing signal which targets the protein to the cell wall. IsdC is believed to make a direct contact with, and transfer heme to, the heme-binding component (IsdE) of an ABC transporter in the cytoplasmic membrane, and to receive heme from other NEAT-containing heme-binding proteins also localized in the cell wall.
Probab=26.39 E-value=57 Score=22.80 Aligned_cols=9 Identities=33% Similarity=0.648 Sum_probs=5.6
Q ss_pred CchHHHHHH
Q 046678 1 MAKFTIVCF 9 (74)
Q Consensus 1 M~k~s~~~~ 9 (74)
|+|++-+++
T Consensus 1 mk~~~~~~~ 9 (217)
T TIGR03656 1 MKKILVFAF 9 (217)
T ss_pred CcchhhHHH
Confidence 888774433
No 57
>PLN00214 putative protein; Provisional
Probab=26.22 E-value=28 Score=22.06 Aligned_cols=12 Identities=33% Similarity=0.764 Sum_probs=6.8
Q ss_pred CchHH--HHHHHHH
Q 046678 1 MAKFT--IVCFLLA 12 (74)
Q Consensus 1 M~k~s--~~~~lil 12 (74)
|+|++ +..++|+
T Consensus 1 m~~~~~~~~~~~~~ 14 (115)
T PLN00214 1 MSKFSSQITTLFIV 14 (115)
T ss_pred CCccccchhHHHHH
Confidence 77765 4444444
No 58
>PHA03066 Hypothetical protein; Provisional
Probab=25.82 E-value=79 Score=19.91 Aligned_cols=17 Identities=24% Similarity=0.522 Sum_probs=8.1
Q ss_pred CchHHHHHHHHHHHHHh
Q 046678 1 MAKFTIVCFLLAFLLVS 17 (74)
Q Consensus 1 M~k~s~~~~lil~~l~s 17 (74)
|+-...++|+++|++.+
T Consensus 1 ~~~~~~l~fFi~Fl~~~ 17 (110)
T PHA03066 1 ASSLLYLLFFIIFLCIS 17 (110)
T ss_pred CchHHHHHHHHHHHHHH
Confidence 44444445555555443
No 59
>PF08120 Toxin_32: Tamulustoxin family; InterPro: IPR012636 This family consists of the tamulustoxins, which are found in the venom of Mesobuthus tamulus (Eastern Indian scorpion) (Buthus tamulus). Tamulustoxin shares no similarity with other scorpion venom toxins, although the positions of its six cysteine residues suggest that it shares the same structural scaffold. Tamulustoxin acts as a potassium channel blocker [].; GO: 0019870 potassium channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region
Probab=25.79 E-value=19 Score=17.80 Aligned_cols=28 Identities=39% Similarity=0.850 Sum_probs=17.7
Q ss_pred chHHHhhhhCCC-ccEeeccCCCCCCCceEEe
Q 046678 41 QCKADCQKNYKG-TGWCDFHKAIPPEKYCFCQ 71 (74)
Q Consensus 41 ~C~~~C~~~~~g-~G~C~~~~~~~~~~~C~C~ 71 (74)
-|..+|....-| .|.|. ... ..+.|.|.
T Consensus 6 icttdcrrnspgtygecv--kke-kgkecvck 34 (35)
T PF08120_consen 6 ICTTDCRRNSPGTYGECV--KKE-KGKECVCK 34 (35)
T ss_pred EeccccccCCCCchhhhh--hhc-cCccceec
Confidence 466677766655 69998 332 35668773
No 60
>PF11839 DUF3359: Protein of unknown function (DUF3359); InterPro: IPR021793 This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are about 80 amino acids in length.
Probab=25.63 E-value=82 Score=19.29 Aligned_cols=15 Identities=40% Similarity=0.512 Sum_probs=9.3
Q ss_pred CchHHHHHHHHHHHH
Q 046678 1 MAKFTIVCFLLAFLL 15 (74)
Q Consensus 1 M~k~s~~~~lil~~l 15 (74)
|.|++++.+.+.++|
T Consensus 1 M~k~l~sal~~~~~L 15 (96)
T PF11839_consen 1 MKKLLLSALALAALL 15 (96)
T ss_pred CchHHHHHHHHHHHH
Confidence 888886665544333
No 61
>PF00299 Squash: Squash family serine protease inhibitor; InterPro: IPR000737 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties. The squash inhibitors form one of a number of serine proteinase inhibitor families. They belong to MEROPS inhibitor family I7, clan IE. They are generally annotated as either trypsin or elastase inhibitors (MEROPS peptidase family S1, IPR001254 from INTERPRO). The proteins, found exclusively in the seeds of the cucurbitaceae, e.g. Citrullus lanatus (watermelon), Cucumis sativus (cucumber), Momordica charantia (balsam pear), are approximately 30 residues in length and contain 6 Cys residues, which form 3 disulphide bonds []. The inhibitors function by being taken up by a serine protease (such as trypsin), which cleaves the peptide bond between Arg/Lys and Ile residues in the N-terminal portion of the protein [, ]. Structural studies have shown that the inhibitor has an ellipsoidal shape, and is largely composed of beta-turns []. The fold and Cys connectivity of the proteins resembles that of potato carboxypeptidase A inhibitor [].; GO: 0004867 serine-type endopeptidase inhibitor activity; PDB: 1MCT_I 2IT8_A 1HA9_A 1IB9_A 2C4B_B 2PO8_A 1F2S_I 1W7Z_H 2LET_A 2ETI_A ....
Probab=25.06 E-value=11 Score=18.37 Aligned_cols=24 Identities=29% Similarity=0.711 Sum_probs=14.7
Q ss_pred ccceee-ecCCCcchHHHhhhhCCC
Q 046678 29 TCEKFW-ACNGDDQCKADCQKNYKG 52 (74)
Q Consensus 29 ~C~~~~-~C~~~~~C~~~C~~~~~g 52 (74)
.|-+++ .|..|++|-..|.=..+|
T Consensus 2 ~CPrIlm~Ck~DsDCl~~C~C~~~g 26 (29)
T PF00299_consen 2 ICPRILMECKRDSDCLAGCICLENG 26 (29)
T ss_dssp -EESBSCB-SSGGGSSTTEEEETTS
T ss_pred CCchhhhhcccccCcccCCEEccCc
Confidence 355666 788877887777655544
No 62
>COG2991 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.95 E-value=1.3e+02 Score=17.69 Aligned_cols=16 Identities=25% Similarity=0.586 Sum_probs=8.6
Q ss_pred ecCCCcchHHHhhhhC
Q 046678 35 ACNGDDQCKADCQKNY 50 (74)
Q Consensus 35 ~C~~~~~C~~~C~~~~ 50 (74)
.|+=+..|+++=++++
T Consensus 44 ~CdC~~pCDt~~~kl~ 59 (77)
T COG2991 44 VCDCDEPCDTHKKKLD 59 (77)
T ss_pred hcCCCCchHHHHHhHH
Confidence 5554456666544443
No 63
>PF03207 OspD: Borrelia outer surface protein D (OspD); InterPro: IPR004894 This is a family of outer surface proteins from Borrelia. The function of these proteins is unknown.
Probab=24.77 E-value=77 Score=21.83 Aligned_cols=18 Identities=39% Similarity=0.480 Sum_probs=10.5
Q ss_pred CchHHHHHHHHHHHHHhc
Q 046678 1 MAKFTIVCFLLAFLLVSD 18 (74)
Q Consensus 1 M~k~s~~~~lil~~l~s~ 18 (74)
|+|+.-++++.+|+|+|.
T Consensus 1 mkklikill~slflllsi 18 (254)
T PF03207_consen 1 MKKLIKILLLSLFLLLSI 18 (254)
T ss_pred ChhHHHHHHHHHHHHHhh
Confidence 777764455555555554
No 64
>PRK15209 long polar fimbrial protein LpfA; Provisional
Probab=24.74 E-value=75 Score=20.39 Aligned_cols=10 Identities=20% Similarity=0.095 Sum_probs=6.1
Q ss_pred CchHHHHHHH
Q 046678 1 MAKFTIVCFL 10 (74)
Q Consensus 1 M~k~s~~~~l 10 (74)
|+|+.+.+++
T Consensus 1 Mkk~~~~~~~ 10 (174)
T PRK15209 1 MKKVVFALSA 10 (174)
T ss_pred CchHHHHHHH
Confidence 8887654433
No 65
>PF12459 DUF3687: D-Ala-teichoic acid biosynthesis protein; InterPro: IPR021008 Proteins in this family are bacterial proteins of approximately 50 amino acids in length. There are two completely conserved residues (L and Y) that may be functionally important. A number of entries are annotated as D-Ala-teichoic acid biosynthesis protein; however there is no direct evidence to support this annotation.
Probab=24.47 E-value=83 Score=16.45 Aligned_cols=7 Identities=14% Similarity=0.467 Sum_probs=3.1
Q ss_pred HHHHHHH
Q 046678 6 IVCFLLA 12 (74)
Q Consensus 6 ~~~~lil 12 (74)
+.+++|+
T Consensus 15 ~fYf~Il 21 (42)
T PF12459_consen 15 LFYFAIL 21 (42)
T ss_pred HHHHHHH
Confidence 3444444
No 66
>PRK11267 biopolymer transport protein ExbD; Provisional
Probab=24.39 E-value=61 Score=20.40 Aligned_cols=10 Identities=20% Similarity=0.544 Sum_probs=5.0
Q ss_pred HHHHHHHHHH
Q 046678 6 IVCFLLAFLL 15 (74)
Q Consensus 6 ~~~~lil~~l 15 (74)
++|+|++||+
T Consensus 26 Vvf~LLiFFm 35 (141)
T PRK11267 26 VMLVLLIIFM 35 (141)
T ss_pred HHHHHHHHHH
Confidence 4555555333
No 67
>TIGR02209 ftsL_broad cell division protein FtsL. This model represents FtsL, both forms similar to that in E. coli and similar to that in B. subtilis. FtsL is one of the later proteins active in cell division septum formation. FtsL is small, low in complexity, and highly divergent. The scope of this model is broader than that of the Pfam model pfam04999.3 for FtsL, as this one includes FtsL from Bacillus subtilis and related species.
Probab=23.56 E-value=96 Score=17.40 Aligned_cols=10 Identities=20% Similarity=0.345 Sum_probs=5.0
Q ss_pred CchHHHHHHH
Q 046678 1 MAKFTIVCFL 10 (74)
Q Consensus 1 M~k~s~~~~l 10 (74)
|+++.+++++
T Consensus 1 ~~~l~~~l~~ 10 (85)
T TIGR02209 1 EKKLYVLLLL 10 (85)
T ss_pred CchHHHHHHH
Confidence 5565544443
No 68
>PF00029 Connexin: Connexin; InterPro: IPR013092 The connexins are a family of integral membrane proteins that oligomerise to form intercellular channels that are clustered at gap junctions. These channels are specialised sites of cell-cell contact that allow the passage of ions, intracellular metabolites and messenger molecules (with molecular weight less than 1-2kDa) from the cytoplasm of one cell to its opposing neighbours. They are found in almost all vertebrate cell types, and somewhat similar proteins have been cloned from plant species. Invertebrates utilise a different family of molecules, innexins, that share a similar predicted secondary structure to the vertebrate connexins, but have no sequence identity to them []. Vertebrate gap junction channels are thought to participate in diverse biological functions. For instance, in the heart they permit the rapid cell-cell transfer of action potentials, ensuring coordinated contraction of the cardiomyocytes. They are also responsible for neurotransmission at specialised 'electrical' synapses. In non-excitable tissues, such as the liver, they may allow metabolic cooperation between cells. In the brain, glial cells are extensively-coupled by gap junctions; this allows waves of intracellular Ca2+ to propagate through nervous tissue, and may contribute to their ability to spatially-buffer local changes in extracellular K+ concentration []. The connexin protein family is encoded by at least 13 genes in rodents, with many homologues cloned from other species. They show overlapping tissue expression patterns, most tissues expressing more than one connexin type. Their conductances, permeability to different molecules, phosphorylation and voltage-dependence of their gating, have been found to vary. Possible communication diversity is increased further by the fact that gap junctions may be formed by the association of different connexin isoforms from apposing cells. However, in vitro studies have shown that not all possible combinations of connexins produce active channels [, ]. Hydropathy analysis predicts that all cloned connexins share a common transmembrane (TM) topology. Each connexin is thought to contain 4 TM domains, with two extracellular and three cytoplasmic regions. This model has been validated for several of the family members by in vitro biochemical analysis. Both N- and C-termini are thought to face the cytoplasm, and the third TM domain has an amphipathic character, suggesting that it contributes to the lining of the formed-channel. Amino acid sequence identity between the isoforms is ~50-80%, with the TM domains being well conserved. Both extracellular loops contain characteristically conserved cysteine residues, which likely form intramolecular disulphide bonds. By contrast, the single putative intracellular loop (between TM domains 2 and 3) and the cytoplasmic C terminus are highly variable among the family members. Six connexins are thought to associate to form a hemi-channel, or connexon. Two connexons then interact (likely via the extracellular loops of their connexins) to form the complete gap junction channel. NH2-*** *** *************-COOH ** ** ** ** ** ** ** ** Cytoplasmic ---**----**-----**----**---------------- ** ** ** ** Membrane ** ** ** ** ---**----**-----**----**---------------- ** ** ** ** Extracellular ** ** ** ** ** ** Two sets of nomenclature have been used to identify the connexins. The first, and most commonly used, classifies the connexin molecules according to molecular weight, such as connexin43 (abbreviated to Cx43), indicating a connexin of molecular weight close to 43kDa. However, studies have revealed cases where clear functional homologues exist across species that have quite different molecular masses; therefore, an alternative nomenclature was proposed based on evolutionary considerations, which divides the family into two major subclasses, alpha and beta, each with a number of members []. Due to their ubiquity and overlapping tissue distributions, it has proved difficult to elucidate the functions of individual connexin isoforms. To circumvent this problem, particular connexin-encoding genes have been subjected to targeted-disruption in mice, and the phenotype of the resulting animals investigated. Around half the connexin isoforms have been investigated in this manner []. Further insight into the functional roles of connexins has come from the discovery that a number of human diseases are caused by mutations in connexin genes. For instance, mutations in Cx32 give rise to a form of inherited peripheral neuropathy called X-linked dominant Charcot-Marie-Tooth disease []. Similarly, mutations in Cx26 are responsible for both autosomal recessive and dominant forms of nonsyndromic deafness, a disorder characterised by hearing loss, with no apparent effects on other organ systems. This domain is found in the N-terminal region of these proteins.; PDB: 2ZW3_F.
Probab=23.01 E-value=1.1e+02 Score=18.97 Aligned_cols=18 Identities=22% Similarity=0.639 Sum_probs=11.0
Q ss_pred ecCC-CcchHHHhhhhCCC
Q 046678 35 ACNG-DDQCKADCQKNYKG 52 (74)
Q Consensus 35 ~C~~-~~~C~~~C~~~~~g 52 (74)
.|+. ..-|++.|.++...
T Consensus 51 ~CnT~qpGC~nvCyn~f~P 69 (107)
T PF00029_consen 51 VCNTLQPGCENVCYNQFFP 69 (107)
T ss_dssp EES---TTHHHHHHHTT-S
T ss_pred CCCCCCCCccceeeccccC
Confidence 5554 34699999887753
No 69
>KOG1443 consensus Predicted integral membrane protein [Function unknown]
Probab=22.79 E-value=58 Score=24.30 Aligned_cols=9 Identities=33% Similarity=0.504 Sum_probs=5.8
Q ss_pred CchHHHHHH
Q 046678 1 MAKFTIVCF 9 (74)
Q Consensus 1 M~k~s~~~~ 9 (74)
|+|+|.+.|
T Consensus 115 M~KSSsi~F 123 (349)
T KOG1443|consen 115 MTKSSSILF 123 (349)
T ss_pred eccccHHHH
Confidence 888884333
No 70
>PRK15240 resistance to complement killing; Provisional
Probab=22.60 E-value=79 Score=21.10 Aligned_cols=12 Identities=33% Similarity=0.587 Sum_probs=8.4
Q ss_pred CchHHHHHHHHH
Q 046678 1 MAKFTIVCFLLA 12 (74)
Q Consensus 1 M~k~s~~~~lil 12 (74)
|+|.+++.++++
T Consensus 1 Mkk~~~~~~~~~ 12 (185)
T PRK15240 1 MKKIVLSSLLLS 12 (185)
T ss_pred CchhHHHHHHHH
Confidence 899887665544
No 71
>PF02553 CbiN: Cobalt transport protein component CbiN; InterPro: IPR003705 The cobalt transport protein CbiN is part of the active cobalt transport system involved in uptake of cobalt in to the cell involved with cobalamin biosynthesis (vitamin B12). It has been suggested that CbiN may function as the periplasmic binding protein component of the active cobalt transport system [].; GO: 0015087 cobalt ion transmembrane transporter activity, 0006824 cobalt ion transport, 0009236 cobalamin biosynthetic process, 0016020 membrane
Probab=22.50 E-value=80 Score=18.43 Aligned_cols=9 Identities=11% Similarity=0.390 Sum_probs=4.8
Q ss_pred CchHHHHHH
Q 046678 1 MAKFTIVCF 9 (74)
Q Consensus 1 M~k~s~~~~ 9 (74)
|+|+.++.+
T Consensus 1 ~kn~~l~~~ 9 (74)
T PF02553_consen 1 MKNLLLLLL 9 (74)
T ss_pred CceeHHHHH
Confidence 667654333
No 72
>PRK11443 lipoprotein; Provisional
Probab=22.46 E-value=80 Score=19.97 Aligned_cols=6 Identities=50% Similarity=0.706 Sum_probs=3.5
Q ss_pred CchHHH
Q 046678 1 MAKFTI 6 (74)
Q Consensus 1 M~k~s~ 6 (74)
|+|+.+
T Consensus 1 Mk~~~~ 6 (124)
T PRK11443 1 MKKFIA 6 (124)
T ss_pred ChHHHH
Confidence 765554
No 73
>PRK10780 periplasmic chaperone; Provisional
Probab=22.45 E-value=93 Score=20.05 Aligned_cols=12 Identities=25% Similarity=0.169 Sum_probs=7.5
Q ss_pred CchHHHHHHHHH
Q 046678 1 MAKFTIVCFLLA 12 (74)
Q Consensus 1 M~k~s~~~~lil 12 (74)
|+|+....+|.+
T Consensus 1 Mkk~~~~~~l~l 12 (165)
T PRK10780 1 MKKWLLAAGLGL 12 (165)
T ss_pred ChHHHHHHHHHH
Confidence 888886544433
No 74
>TIGR02801 tolR TolR protein. The model describes the inner membrane protein TolR, part of the TolR/TolQ complex that transduces energy from the proton-motive force, through TolA, to an outer membrane complex made up of TolB and Pal (peptidoglycan-associated lipoprotein). The complex is required to maintain outer membrane integrity, and defects may cause a defect in the import of some organic compounds in addition to the resulting morphologic. While several gene pairs homologous to talR and tolQ may be found in a single genome, but the scope of this model is set to favor finding only bone fide TolR, supported by operon structure as well as by score.
Probab=22.25 E-value=90 Score=19.03 Aligned_cols=14 Identities=21% Similarity=0.432 Sum_probs=6.7
Q ss_pred HHHHHHH-HHHHhcc
Q 046678 6 IVCFLLA-FLLVSDG 19 (74)
Q Consensus 6 ~~~~lil-~~l~s~~ 19 (74)
++|+|++ |++.+.+
T Consensus 13 VvFlLLiFFmvts~~ 27 (129)
T TIGR02801 13 VMLVLLIIFMVTAPL 27 (129)
T ss_pred HHHHHHHHHHhhhcc
Confidence 4555555 4444443
No 75
>PF12276 DUF3617: Protein of unknown function (DUF3617); InterPro: IPR022061 This family of proteins is found in bacteria. Proteins in this family are typically between 155 and 179 amino acids in length. There is a single completely conserved residue C that may be functionally important.
Probab=22.05 E-value=88 Score=19.65 Aligned_cols=13 Identities=23% Similarity=0.421 Sum_probs=7.8
Q ss_pred CchHHHHHHHHHH
Q 046678 1 MAKFTIVCFLLAF 13 (74)
Q Consensus 1 M~k~s~~~~lil~ 13 (74)
|+++.++++++++
T Consensus 1 M~~~~~~~~~~~~ 13 (162)
T PF12276_consen 1 MKRRLLLALALAL 13 (162)
T ss_pred CchHHHHHHHHHH
Confidence 7777765555443
No 76
>PF10855 DUF2648: Protein of unknown function (DUF2648); InterPro: IPR022561 This family of proteins with unknown function appears to be restricted to eubacteia.
Probab=22.05 E-value=38 Score=16.87 Aligned_cols=10 Identities=40% Similarity=0.677 Sum_probs=6.6
Q ss_pred CchHHHHHHH
Q 046678 1 MAKFTIVCFL 10 (74)
Q Consensus 1 M~k~s~~~~l 10 (74)
|+|++|+.++
T Consensus 1 MKkl~i~L~l 10 (33)
T PF10855_consen 1 MKKLAIILIL 10 (33)
T ss_pred CCceeehhhh
Confidence 8888865443
No 77
>TIGR02804 ExbD_2 TonB system transport protein ExbD, group 2. Members of this family are Gram-negative bacterial inner membrane proteins, generally designated ExbD, related to the TolR family modeled by TIGRFAMs TIGR02801. Members always are encoded next to a protein designated ExbB (TIGR02797), related to the TolQ family modeled by TIGRFAMs TIGR02796. ExbD and ExbB together form a proton channel through which they can harness the proton-motive force to energize TonB, which in turn energizes TonB-dependent receptors in the outer membrane. TonB-dependent receptors with known specificity tend to import siderophores or vitamin B12. A TonB system and Tol-Pal system often will co-exist in a single bacterial genome.
Probab=21.79 E-value=78 Score=19.28 Aligned_cols=13 Identities=46% Similarity=0.687 Sum_probs=6.1
Q ss_pred HHHHHHH-HHHHhc
Q 046678 6 IVCFLLA-FLLVSD 18 (74)
Q Consensus 6 ~~~~lil-~~l~s~ 18 (74)
++|+|++ |++.+.
T Consensus 12 VvflLLiFFmvtt~ 25 (121)
T TIGR02804 12 IMLVLLAIVLIIST 25 (121)
T ss_pred HHHHHHHHHHHHHH
Confidence 4555555 444443
No 78
>PRK11024 colicin uptake protein TolR; Provisional
Probab=21.76 E-value=87 Score=19.64 Aligned_cols=13 Identities=23% Similarity=0.496 Sum_probs=6.2
Q ss_pred HHHHHHH-HHHHhc
Q 046678 6 IVCFLLA-FLLVSD 18 (74)
Q Consensus 6 ~~~~lil-~~l~s~ 18 (74)
++|+|++ |++.+.
T Consensus 23 VvfvLLiFFmvts~ 36 (141)
T PRK11024 23 VLLVLLLIFMATAP 36 (141)
T ss_pred HHHHHHHHHHhccc
Confidence 4556555 434333
No 79
>PRK06667 motB flagellar motor protein MotB; Validated
Probab=21.73 E-value=73 Score=22.05 Aligned_cols=12 Identities=25% Similarity=0.880 Sum_probs=5.1
Q ss_pred HHHHHHHHHHhc
Q 046678 7 VCFLLAFLLVSD 18 (74)
Q Consensus 7 ~~~lil~~l~s~ 18 (74)
+.|||+|+.+|.
T Consensus 30 L~FFVlL~smS~ 41 (252)
T PRK06667 30 LCFFVMLFTTND 41 (252)
T ss_pred HHHHHHHHHhhh
Confidence 334444444444
No 80
>PF06291 Lambda_Bor: Bor protein; InterPro: IPR010438 This family consists of several Bacteriophage lambda Bor and Escherichia coli Iss proteins. Expression of bor significantly increases the survival of the E. coli host cell in animal serum. This property is a well known bacterial virulence determinant indeed, bor and its adjacent sequences are highly homologous to the iss serum resistance locus of the plasmid ColV2-K94, which confers virulence in animals. It has been suggested that lysogeny may generally have a role in bacterial survival in animal hosts, and perhaps in pathogenesis [].
Probab=21.66 E-value=88 Score=19.07 Aligned_cols=12 Identities=25% Similarity=0.293 Sum_probs=8.0
Q ss_pred CchHHHHHHHHH
Q 046678 1 MAKFTIVCFLLA 12 (74)
Q Consensus 1 M~k~s~~~~lil 12 (74)
|+|..+...+.+
T Consensus 1 mKk~ll~~~lal 12 (97)
T PF06291_consen 1 MKKLLLAAALAL 12 (97)
T ss_pred CcHHHHHHHHHH
Confidence 888886555543
No 81
>PF09403 FadA: Adhesion protein FadA; InterPro: IPR018543 FadA (Fusobacterium adhesin A) is an adhesin which forms two alpha helices. ; PDB: 3ETZ_B 3ETY_A 2GL2_B 3ETX_C 3ETW_A.
Probab=21.33 E-value=31 Score=21.99 Aligned_cols=12 Identities=33% Similarity=0.495 Sum_probs=0.0
Q ss_pred CchHHHHHHHHH
Q 046678 1 MAKFTIVCFLLA 12 (74)
Q Consensus 1 M~k~s~~~~lil 12 (74)
|+|+.++++|++
T Consensus 1 MKK~ll~~~lll 12 (126)
T PF09403_consen 1 MKKILLLGMLLL 12 (126)
T ss_dssp ------------
T ss_pred ChHHHHHHHHHH
Confidence 888665544433
No 82
>PHA02691 hypothetical protein; Provisional
Probab=20.88 E-value=1.2e+02 Score=19.15 Aligned_cols=16 Identities=31% Similarity=0.306 Sum_probs=7.4
Q ss_pred CchHHHHHHHHHHHHH
Q 046678 1 MAKFTIVCFLLAFLLV 16 (74)
Q Consensus 1 M~k~s~~~~lil~~l~ 16 (74)
|+-..-++|+|+|++.
T Consensus 1 ~~~l~~l~fFi~FL~l 16 (110)
T PHA02691 1 MSWALEVALFAAFLAA 16 (110)
T ss_pred CchHHHHHHHHHHHHH
Confidence 4444434455554443
No 83
>PF11153 DUF2931: Protein of unknown function (DUF2931); InterPro: IPR021326 Some members in this family of proteins are annotated as lipoproteins however this cannot be confirmed. Currently, there is no known function.
Probab=20.65 E-value=86 Score=21.01 Aligned_cols=8 Identities=25% Similarity=0.413 Sum_probs=5.5
Q ss_pred CchHHHHH
Q 046678 1 MAKFTIVC 8 (74)
Q Consensus 1 M~k~s~~~ 8 (74)
|+|+++++
T Consensus 1 mk~i~~l~ 8 (216)
T PF11153_consen 1 MKKILLLL 8 (216)
T ss_pred ChHHHHHH
Confidence 77777654
No 84
>PF12809 Metallothi_Euk2: Eukaryotic metallothionein
Probab=20.29 E-value=47 Score=19.61 Aligned_cols=33 Identities=18% Similarity=0.511 Sum_probs=20.1
Q ss_pred cchHHHhhhhCCCccEeeccCCCCCCCceEEee
Q 046678 40 DQCKADCQKNYKGTGWCDFHKAIPPEKYCFCQY 72 (74)
Q Consensus 40 ~~C~~~C~~~~~g~G~C~~~~~~~~~~~C~C~y 72 (74)
+.|.+.|..+..+...|.--.+.|.++.|-|..
T Consensus 17 ~~CeshC~ekgSegslCq~~~ffGqyr~cpC~~ 49 (80)
T PF12809_consen 17 DHCESHCAEKGSEGSLCQTQAFFGQYRCCPCLR 49 (80)
T ss_pred chhhccccccCCCCcceeeeeecCCcccCchhc
Confidence 358888888877766666323445455555543
No 85
>cd00150 PlantTI Plant trypsin inhibitors such as squash trypsin inhibitor. Plant proteinase inhibitors play important roles in natural plant defense. Proteinase inhibitors from squash seeds form an uniform family of small proteins cross-linked with three disulfide bridges.
Probab=20.27 E-value=24 Score=16.86 Aligned_cols=17 Identities=29% Similarity=0.663 Sum_probs=10.7
Q ss_pred ecCCCcchHHHhhhhCC
Q 046678 35 ACNGDDQCKADCQKNYK 51 (74)
Q Consensus 35 ~C~~~~~C~~~C~~~~~ 51 (74)
.|..|++|-..|.=..+
T Consensus 7 ~Ck~DsDCl~~CiC~~~ 23 (27)
T cd00150 7 ECKRDSDCLAECICLEN 23 (27)
T ss_pred eccccccccCCCEEccc
Confidence 67666777666664444
No 86
>TIGR00156 conserved hypothetical protein TIGR00156. As of the last revision, this family consists only of two proteins from Escherichia coli and one from the related species Haemophilus influenzae.
Probab=20.13 E-value=92 Score=19.87 Aligned_cols=10 Identities=30% Similarity=0.006 Sum_probs=6.8
Q ss_pred CchHHHHHHH
Q 046678 1 MAKFTIVCFL 10 (74)
Q Consensus 1 M~k~s~~~~l 10 (74)
|+|+.++.++
T Consensus 1 MKK~~~~~~~ 10 (126)
T TIGR00156 1 MKFQAIVLAS 10 (126)
T ss_pred CchHHHHHHH
Confidence 8897765554
Done!