Query         046686
Match_columns 70
No_of_seqs    103 out of 155
Neff          5.2 
Searched_HMMs 46136
Date          Fri Mar 29 03:26:39 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/046686.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/046686hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR00625 tfb2 Transcription f 100.0 3.2E-30 6.9E-35  196.9   6.4   70    1-70    379-448 (448)
  2 KOG3471 RNA polymerase II tran 100.0 2.9E-30 6.4E-35  196.3   4.9   70    1-70    394-463 (465)
  3 COG5144 TFB2 RNA polymerase II  99.9 3.3E-25 7.2E-30  166.5   5.8   69    1-69    377-445 (447)
  4 PF10566 Glyco_hydro_97:  Glyco  81.5     3.5 7.7E-05   30.3   4.6   24   25-48     72-97  (273)
  5 cd06568 GH20_SpHex_like A subg  76.6     2.9 6.3E-05   30.9   2.9   24   19-42     68-91  (329)
  6 cd06569 GH20_Sm-chitobiase-lik  75.5     3.2 6.9E-05   32.1   3.0   24   19-42     90-113 (445)
  7 cd02742 GH20_hexosaminidase Be  72.6     3.9 8.5E-05   29.6   2.7   25   18-42     64-88  (303)
  8 cd06563 GH20_chitobiase-like T  72.6     3.6 7.7E-05   30.5   2.6   24   19-42     79-102 (357)
  9 cd06564 GH20_DspB_LnbB-like Gl  72.4     4.3 9.3E-05   29.6   2.9   25   18-42     74-98  (326)
 10 cd06562 GH20_HexA_HexB-like Be  72.2     3.8 8.2E-05   30.4   2.6   23   20-42     64-86  (348)
 11 cd06570 GH20_chitobiase-like_1  72.2     4.5 9.8E-05   29.8   3.0   24   19-42     61-84  (311)
 12 PF13496 DUF4120:  Domain of un  69.9     4.3 9.2E-05   25.8   2.1   17   24-40      4-20  (95)
 13 PF08671 SinI:  Anti-repressor   68.9     8.8 0.00019   19.6   2.8   28   26-69      3-30  (30)
 14 PF02244 Propep_M14:  Carboxype  66.3      22 0.00047   20.1   6.2   46   23-68      6-55  (74)
 15 cd06565 GH20_GcnA-like Glycosy  64.9     8.3 0.00018   28.0   3.1   23   20-42     54-76  (301)
 16 PF00728 Glyco_hydro_20:  Glyco  62.2     6.4 0.00014   28.2   2.1   21   22-42     69-89  (351)
 17 COG4379 Mu-like prophage tail   56.2      19  0.0004   28.1   3.7   31   23-53    149-179 (386)
 18 PF03102 NeuB:  NeuB family;  I  56.0      14 0.00031   26.4   3.0   24   23-46     53-76  (241)
 19 cd07241 Glo_EDI_BRP_like_3 Thi  51.1      44 0.00096   19.3   4.2   38   21-58     77-120 (125)
 20 cd07265 2_3_CTD_N N-terminal d  50.2      43 0.00092   19.8   4.1   38   21-58     68-112 (122)
 21 cd01998 tRNA_Me_trans tRNA met  45.7      24 0.00052   26.2   2.9   37   29-68    170-207 (349)
 22 cd07252 BphC1-RGP6_N_like N-te  44.4      54  0.0012   19.5   3.9   38   21-58     64-110 (120)
 23 PF08727 P3A:  Poliovirus 3A pr  41.3      15 0.00032   21.5   0.9   19   24-42     25-43  (57)
 24 PLN02955 8-amino-7-oxononanoat  41.2      49  0.0011   26.2   4.1   55    9-64    250-304 (476)
 25 cd07242 Glo_EDI_BRP_like_6 Thi  38.0      85  0.0019   18.4   4.3   37   22-58     76-121 (128)
 26 COG1313 PflX Uncharacterized F  37.9      34 0.00073   26.3   2.6   20   21-40    310-329 (335)
 27 PF10087 DUF2325:  Uncharacteri  37.6      68  0.0015   19.2   3.6   34   11-44     46-80  (97)
 28 cd08351 ChaP_like ChaP, an enz  37.2      85  0.0018   18.6   4.0   21   24-44     67-87  (123)
 29 smart00702 P4Hc Prolyl 4-hydro  37.2      49  0.0011   21.4   3.1   24   16-39      3-26  (178)
 30 cd07263 Glo_EDI_BRP_like_16 Th  36.1      83  0.0018   17.7   3.7   33   26-58     76-113 (119)
 31 cd07238 Glo_EDI_BRP_like_5 Thi  35.3      52  0.0011   19.0   2.7   34   25-58     65-104 (112)
 32 PF09286 Pro-kuma_activ:  Pro-k  34.9 1.2E+02  0.0026   19.2   4.8   32   24-55     60-92  (143)
 33 cd08357 Glo_EDI_BRP_like_18 Th  34.6      83  0.0018   18.2   3.6   35   25-59     75-119 (125)
 34 PF13344 Hydrolase_6:  Haloacid  34.6      41 0.00089   20.4   2.3   17   48-64     31-47  (101)
 35 PRK00143 mnmA tRNA-specific 2-  34.1      38 0.00083   25.1   2.4   37   29-68    169-206 (346)
 36 PRK09480 slmA division inhibit  33.7      15 0.00033   23.5   0.2   24   10-33     39-63  (194)
 37 PF02836 Glyco_hydro_2_C:  Glyc  33.4      41 0.00089   23.8   2.4   18   29-46     62-79  (298)
 38 PRK11675 LexA regulated protei  32.9      46   0.001   20.9   2.3   18   23-40     57-74  (90)
 39 PF09756 DDRGK:  DDRGK domain;   32.6      23  0.0005   24.8   1.0   24   45-68    148-171 (188)
 40 cd08345 Fosfomycin_RP Fosfomyc  32.3      86  0.0019   17.9   3.3   33   26-58     66-104 (113)
 41 PF05954 Phage_GPD:  Phage late  32.1      90   0.002   21.2   3.9   33   23-55    120-152 (292)
 42 smart00348 IRF interferon regu  31.6      40 0.00086   21.5   1.9   17   38-54     15-31  (107)
 43 cd08344 MhqB_like_N N-terminal  30.9   1E+02  0.0022   17.9   3.5   36   24-59     64-103 (112)
 44 cd07233 Glyoxalase_I Glyoxalas  30.9      78  0.0017   18.2   3.0   33   26-58     79-116 (121)
 45 cd08354 Glo_EDI_BRP_like_13 Th  30.3      95  0.0021   17.8   3.3   37   21-58     74-115 (122)
 46 PRK00767 transcriptional regul  30.0      18  0.0004   23.2   0.1   26   11-36     39-65  (197)
 47 PRK10668 DNA-binding transcrip  29.7      28 0.00061   22.9   1.0   25   11-35     41-66  (215)
 48 PRK07534 methionine synthase I  29.5 1.1E+02  0.0024   22.8   4.2   32   14-45    145-176 (336)
 49 COG1435 Tdk Thymidine kinase [  28.9 1.1E+02  0.0024   21.9   3.9   35   14-48     83-119 (201)
 50 PRK00464 nrdR transcriptional   28.8      45 0.00099   22.5   1.9   21   16-36    128-148 (154)
 51 cd00531 NTF2_like Nuclear tran  28.8      62  0.0013   18.0   2.3   42   25-68     14-55  (124)
 52 cd08362 BphC5-RrK37_N_like N-t  28.6 1.2E+02  0.0027   17.4   3.9   37   22-58     66-110 (120)
 53 PLN00052 prolyl 4-hydroxylase;  28.5      57  0.0012   24.3   2.5   24   15-38     55-78  (310)
 54 COG3525 Chb N-acetyl-beta-hexo  27.6      60  0.0013   27.4   2.7   25   18-42    338-362 (732)
 55 TIGR00789 flhB_rel flhB C-term  27.2      47   0.001   20.2   1.6   19   29-47     30-48  (82)
 56 COG2154 Pterin-4a-carbinolamin  26.9      85  0.0018   20.1   2.8   54    4-58     21-76  (101)
 57 PF00464 SHMT:  Serine hydroxym  26.7      94   0.002   24.0   3.5   29   20-48    178-206 (399)
 58 PF15252 DUF4589:  Domain of un  26.6      31 0.00067   25.1   0.8   17    7-23    130-146 (221)
 59 KOG2230 Predicted beta-mannosi  26.5      28  0.0006   29.3   0.6   32    7-45    370-401 (867)
 60 PRK11202 DNA-binding transcrip  26.1      40 0.00087   22.4   1.3   25   10-34     41-66  (203)
 61 PF13707 RloB:  RloB-like prote  26.1 1.2E+02  0.0026   19.6   3.6   23   24-46     75-98  (183)
 62 PF01378 IgG_binding_B:  B doma  26.1 1.1E+02  0.0024   17.7   2.9   25   30-54     28-54  (55)
 63 TIGR03613 RutR pyrimidine util  26.0      22 0.00047   23.1  -0.1   28   10-37     37-65  (202)
 64 cd07261 Glo_EDI_BRP_like_11 Th  25.7 1.4E+02  0.0031   17.1   4.8   43   16-58     61-108 (114)
 65 cd08361 PpCmtC_N N-terminal do  25.5 1.3E+02  0.0029   18.0   3.5   39   21-59     66-113 (124)
 66 COG4509 Uncharacterized protei  25.4      78  0.0017   23.3   2.7   29   13-41    178-206 (244)
 67 PF02677 DUF208:  Uncharacteriz  24.9      57  0.0012   22.7   1.8   27   15-41    136-162 (176)
 68 TIGR03569 NeuB_NnaB N-acetylne  24.7      89  0.0019   23.4   3.0   24   23-46     73-96  (329)
 69 PF13018 ESPR:  Extended Signal  24.4      98  0.0021   14.8   2.2   16   40-55      6-21  (24)
 70 PF00440 TetR_N:  Bacterial reg  24.1      14 0.00029   19.4  -1.1   20   10-29     25-44  (47)
 71 PF07845 DUF1636:  Protein of u  24.0      65  0.0014   20.8   1.9   32   15-46     66-102 (116)
 72 cd07244 FosA FosA, a Fosfomyci  23.9 1.6E+02  0.0034   17.4   3.5   34   25-58     67-103 (121)
 73 PF03588 Leu_Phe_trans:  Leucyl  23.8      87  0.0019   21.6   2.6   31   37-67     19-51  (173)
 74 PF12696 TraG-D_C:  TraM recogn  23.3 1.1E+02  0.0023   19.0   2.7   27   17-43      4-33  (128)
 75 PF10662 PduV-EutP:  Ethanolami  22.9 2.3E+02  0.0049   18.9   4.4   36   24-66    104-142 (143)
 76 PF07409 GP46:  Phage protein G  22.9      52  0.0011   21.3   1.3   28    2-43     45-72  (116)
 77 cd07255 Glo_EDI_BRP_like_12 Th  22.8 1.7E+02  0.0036   16.9   4.0   37   22-58     72-112 (125)
 78 TIGR02432 lysidine_TilS_N tRNA  22.6 1.1E+02  0.0023   19.9   2.8   19   29-47    154-172 (189)
 79 PRK14996 TetR family transcrip  22.5      36 0.00078   22.1   0.5   22   10-31     37-59  (192)
 80 PF12681 Glyoxalase_2:  Glyoxal  22.0 1.6E+02  0.0035   16.5   3.3   33   26-58     65-103 (108)
 81 COG0436 Aspartate/tyrosine/aro  21.8 1.3E+02  0.0028   22.6   3.4   30   24-53    181-210 (393)
 82 PF11305 DUF3107:  Protein of u  21.7   2E+02  0.0043   17.4   5.1   36   21-56     18-55  (74)
 83 PF03614 Flag1_repress:  Repres  21.7      70  0.0015   22.3   1.8   20   23-42    104-123 (165)
 84 PF00128 Alpha-amylase:  Alpha   21.4      92   0.002   20.9   2.3   24   20-43     46-69  (316)
 85 PRK05569 flavodoxin; Provision  21.4 1.8E+02  0.0038   17.9   3.5   24   15-38    116-139 (141)
 86 PRK09485 mmuM homocysteine met  21.3 1.9E+02   0.004   21.0   4.0   31   14-44    154-186 (304)
 87 cd02407 PTH2_family Peptidyl-t  21.3 1.5E+02  0.0033   18.8   3.2   24   22-45     56-81  (115)
 88 KOG1359 Glycine C-acetyltransf  20.7 2.1E+02  0.0045   22.5   4.2   50    8-58    193-242 (417)
 89 smart00642 Aamy Alpha-amylase   20.5 1.7E+02  0.0037   19.4   3.4   25   21-45     65-89  (166)
 90 PF01402 RHH_1:  Ribbon-helix-h  20.4      94   0.002   15.3   1.7   17   24-40      7-23  (39)
 91 COG2221 DsrA Dissimilatory sul  20.3 2.2E+02  0.0049   21.7   4.3   53   10-66     33-88  (317)
 92 PF01408 GFO_IDH_MocA:  Oxidore  20.1 1.4E+02  0.0031   17.5   2.8   23   22-44     96-118 (120)

No 1  
>TIGR00625 tfb2 Transcription factor tfb2. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=99.96  E-value=3.2e-30  Score=196.89  Aligned_cols=70  Identities=30%  Similarity=0.527  Sum_probs=68.9

Q ss_pred             CcccccccCceeeeceEEecCCCCHHHHHHHHHHHHHcCeEEeeeCCcceEEEeccccHHHHHHHHhhcC
Q 046686            1 IRLWESDLNKDEMTRVHYYDEFPSRDVFEAACDYARDRSGLQWEDSKKMRLVVKAEIHIHIREFLRGQNK   70 (70)
Q Consensus         1 IrLWe~ErnRi~~~~g~Ly~~F~s~~~fe~~~~yA~~~gvLlW~~~~kr~~~V~~~gh~~vr~f~k~~~~   70 (70)
                      |||||+||||+++++||||++|+|++||+++++||+++|||+|+|++||+|||+++||++|++|||++++
T Consensus       379 i~lWe~e~~R~~~~~~~l~~~f~s~~~y~~~~~ya~~~~~l~w~~~~kr~~~V~~~gh~~v~~f~k~~~~  448 (448)
T TIGR00625       379 IRLWELERDRLRFTEGVLYNDFLTQVDFELLLAYARELGVLVWENSAKRLFFITPAGHSDVKRFWKRQKH  448 (448)
T ss_pred             HHHHHHHhcceEeecceeeeecCCHHHHHHHHHHHHHcCEEEEecCCceEEEEeccchHHHHHHHHhhcC
Confidence            7999999999999999999999999999999999999999999999999999999999999999999985


No 2  
>KOG3471 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB2 [Transcription; Replication, recombination and repair]
Probab=99.96  E-value=2.9e-30  Score=196.33  Aligned_cols=70  Identities=37%  Similarity=0.574  Sum_probs=68.4

Q ss_pred             CcccccccCceeeeceEEecCCCCHHHHHHHHHHHHHcCeEEeeeCCcceEEEeccccHHHHHHHHhhcC
Q 046686            1 IRLWESDLNKDEMTRVHYYDEFPSRDVFEAACDYARDRSGLQWEDSKKMRLVVKAEIHIHIREFLRGQNK   70 (70)
Q Consensus         1 IrLWe~ErnRi~~~~g~Ly~~F~s~~~fe~~~~yA~~~gvLlW~~~~kr~~~V~~~gh~~vr~f~k~~~~   70 (70)
                      |||||+||||+.++|||||++|+|..||+.+++||+++|+|+|+|+.||+|||+++||++|++|||+++|
T Consensus       394 IrLWElernR~~~~~g~LYs~Fls~~df~~l~eya~~~~vLvw~d~~kr~~vV~~~Ghs~Vk~f~Kr~~k  463 (465)
T KOG3471|consen  394 IRLWELERNRLRMTEGYLYSDFLSLSDFQLLLEYAREIGVLVWSDSDKRMFVVTKEGHSLVKRFWKRKSK  463 (465)
T ss_pred             HHHHHHhhcceecccchhHHhhhhhhhHHHHHHHHHHcCeEEEecCcceEEEEecCccHHHHHHHHHhhc
Confidence            8999999999999999999999999999999999999999999999999999999999999999999764


No 3  
>COG5144 TFB2 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB2 [Transcription / DNA replication, recombination, and repair]
Probab=99.91  E-value=3.3e-25  Score=166.47  Aligned_cols=69  Identities=28%  Similarity=0.423  Sum_probs=67.7

Q ss_pred             CcccccccCceeeeceEEecCCCCHHHHHHHHHHHHHcCeEEeeeCCcceEEEeccccHHHHHHHHhhc
Q 046686            1 IRLWESDLNKDEMTRVHYYDEFPSRDVFEAACDYARDRSGLQWEDSKKMRLVVKAEIHIHIREFLRGQN   69 (70)
Q Consensus         1 IrLWe~ErnRi~~~~g~Ly~~F~s~~~fe~~~~yA~~~gvLlW~~~~kr~~~V~~~gh~~vr~f~k~~~   69 (70)
                      |+|||+||||+.++||+||+||.+.++|+.+++||++.|||+|+|+.||||||+.+||.+|++|+|++-
T Consensus       377 I~lWele~nRi~~~pG~LysdFlt~s~y~~~~eya~~~gvLvw~d~~Krmffi~~eG~s~v~~f~Kr~l  445 (447)
T COG5144         377 IVLWELERNRIFMVPGYLYSDFLTLSDYQKVLEYAIRGGVLVWSDVDKRMFFIKLEGHSLVKEFVKRIL  445 (447)
T ss_pred             eeeeeeccCcEEeecchHHhhhhchhhHHHHHHHHHhcCeEEeecccceEEEEEccCcHHHHHHHHHHh
Confidence            799999999999999999999999999999999999999999999999999999999999999999974


No 4  
>PF10566 Glyco_hydro_97:  Glycoside hydrolase 97  ;  InterPro: IPR019563 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site.  This is the 97th family of glycosidases, in this case bacterial. The central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, most probably form two additional non-catalytic domains with as yet unknown functions. The non-catalytic domains of glycosidases from the alpha-galactosidase and alpha-glucosidase superfamilies are also predominantly composed of beta-strands, and at least some of these domains are involved in oligomerisation and carbohydrate binding. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands []. ; PDB: 2JKP_A 2JKE_A 2D73_B 2ZQ0_B 2JKA_A 3A24_A.
Probab=81.51  E-value=3.5  Score=30.31  Aligned_cols=24  Identities=21%  Similarity=0.343  Sum_probs=19.4

Q ss_pred             HHHHHHHHHHHHHcC--eEEeeeCCc
Q 046686           25 RDVFEAACDYARDRS--GLQWEDSKK   48 (70)
Q Consensus        25 ~~~fe~~~~yA~~~g--vLlW~~~~k   48 (70)
                      ..+-..|++||++.|  |+||-+...
T Consensus        72 ~~dl~elv~Ya~~KgVgi~lw~~~~~   97 (273)
T PF10566_consen   72 DFDLPELVDYAKEKGVGIWLWYHSET   97 (273)
T ss_dssp             T--HHHHHHHHHHTT-EEEEEEECCH
T ss_pred             ccCHHHHHHHHHHcCCCEEEEEeCCc
Confidence            567889999999999  899988765


No 5  
>cd06568 GH20_SpHex_like A subgroup of  the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex).  SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.
Probab=76.61  E-value=2.9  Score=30.91  Aligned_cols=24  Identities=13%  Similarity=0.216  Sum_probs=21.2

Q ss_pred             ecCCCCHHHHHHHHHHHHHcCeEE
Q 046686           19 YDEFPSRDVFEAACDYARDRSGLQ   42 (70)
Q Consensus        19 y~~F~s~~~fe~~~~yA~~~gvLl   42 (70)
                      ...|.|++|+..+++||++.||-|
T Consensus        68 ~~~~YT~~di~elv~yA~~rgI~v   91 (329)
T cd06568          68 PGGYYTQEDYKDIVAYAAERHITV   91 (329)
T ss_pred             CCCcCCHHHHHHHHHHHHHcCCEE
Confidence            457899999999999999999943


No 6  
>cd06569 GH20_Sm-chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
Probab=75.47  E-value=3.2  Score=32.10  Aligned_cols=24  Identities=21%  Similarity=0.145  Sum_probs=21.5

Q ss_pred             ecCCCCHHHHHHHHHHHHHcCeEE
Q 046686           19 YDEFPSRDVFEAACDYARDRSGLQ   42 (70)
Q Consensus        19 y~~F~s~~~fe~~~~yA~~~gvLl   42 (70)
                      ++.|.|++|+..+++||++.||-|
T Consensus        90 ~~g~YT~~di~eiv~yA~~rgI~V  113 (445)
T cd06569          90 GSGYYSRADYIEILKYAKARHIEV  113 (445)
T ss_pred             cCCccCHHHHHHHHHHHHHcCCEE
Confidence            467899999999999999999855


No 7  
>cd02742 GH20_hexosaminidase Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides.  These enzymes are broadly distributed in microorganisms, plants and animals, and play roles in various key physiological and pathological processes. These processes include cell structural integrity, energy storage, cellular signaling, fertilization, pathogen defense, viral penetration, the development of carcinomas, inflammatory events and lysosomal storage disorders. The GH20 enzymes include the eukaryotic beta-N-acetylhexosaminidases A and B, the bacterial chitobiases, dispersin B, and lacto-N-biosidase.  The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by the solvent or the enzyme, but by the substrate itself.
Probab=72.59  E-value=3.9  Score=29.59  Aligned_cols=25  Identities=16%  Similarity=0.074  Sum_probs=22.1

Q ss_pred             EecCCCCHHHHHHHHHHHHHcCeEE
Q 046686           18 YYDEFPSRDVFEAACDYARDRSGLQ   42 (70)
Q Consensus        18 Ly~~F~s~~~fe~~~~yA~~~gvLl   42 (70)
                      -...|.|++|+..+++||++.||-+
T Consensus        64 ~~~~~yT~~di~elv~yA~~rgI~v   88 (303)
T cd02742          64 SPGGFYTYAQLKDIIEYAAARGIEV   88 (303)
T ss_pred             CCCCeECHHHHHHHHHHHHHcCCEE
Confidence            4567899999999999999999965


No 8  
>cd06563 GH20_chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin.  Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
Probab=72.57  E-value=3.6  Score=30.52  Aligned_cols=24  Identities=21%  Similarity=0.351  Sum_probs=21.0

Q ss_pred             ecCCCCHHHHHHHHHHHHHcCeEE
Q 046686           19 YDEFPSRDVFEAACDYARDRSGLQ   42 (70)
Q Consensus        19 y~~F~s~~~fe~~~~yA~~~gvLl   42 (70)
                      +..|.|++|+..+++||++.||-|
T Consensus        79 ~~~~YT~~di~eiv~yA~~rgI~V  102 (357)
T cd06563          79 YGGFYTQEEIREIVAYAAERGITV  102 (357)
T ss_pred             cCceECHHHHHHHHHHHHHcCCEE
Confidence            357889999999999999999943


No 9  
>cd06564 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway.  The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
Probab=72.40  E-value=4.3  Score=29.61  Aligned_cols=25  Identities=24%  Similarity=0.367  Sum_probs=21.8

Q ss_pred             EecCCCCHHHHHHHHHHHHHcCeEE
Q 046686           18 YYDEFPSRDVFEAACDYARDRSGLQ   42 (70)
Q Consensus        18 Ly~~F~s~~~fe~~~~yA~~~gvLl   42 (70)
                      -.+.|.|++|+..+++||++.||-+
T Consensus        74 ~~~~~YT~~di~eiv~yA~~rgI~v   98 (326)
T cd06564          74 ANDGYYTKEEFKELIAYAKDRGVNI   98 (326)
T ss_pred             CCCCcccHHHHHHHHHHHHHcCCeE
Confidence            3567889999999999999999954


No 10 
>cd06562 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. The hexA and hexB genes encode the alpha- and beta-subunits of the two major beta-N-acetylhexosaminidase isoenzymes, N-acetyl-beta-D-hexosaminidase A (HexA) and beta-N-acetylhexosaminidase B  (HexB). Both the alpha and the beta catalytic subunits have a TIM-barrel fold and belong to the glycosyl hydrolase family 20 (GH20).  The HexA enzyme is a heterodimer containing one alpha and one beta subunit while the HexB enzyme is a homodimer containing two beta-subunits.  Hexosaminidase mutations cause an inability to properly hydrolyze certain sphingolipids which accumulate in lysosomes within the brain, resulting in the lipid storage disorders Tay-Sachs and Sandhoff.  Mutations in the alpha subunit cause in a deficiency in the HexA enzyme and result in 
Probab=72.20  E-value=3.8  Score=30.37  Aligned_cols=23  Identities=22%  Similarity=0.183  Sum_probs=20.4

Q ss_pred             cCCCCHHHHHHHHHHHHHcCeEE
Q 046686           20 DEFPSRDVFEAACDYARDRSGLQ   42 (70)
Q Consensus        20 ~~F~s~~~fe~~~~yA~~~gvLl   42 (70)
                      +.|.|++|+..+++||++.||-+
T Consensus        64 ~~~YT~~di~eiv~yA~~rgI~v   86 (348)
T cd06562          64 SEVYTPEDVKEIVEYARLRGIRV   86 (348)
T ss_pred             CceECHHHHHHHHHHHHHcCCEE
Confidence            46789999999999999999854


No 11 
>cd06570 GH20_chitobiase-like_1 A functionally uncharacterized subgroup of  the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin.  Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
Probab=72.18  E-value=4.5  Score=29.82  Aligned_cols=24  Identities=21%  Similarity=0.257  Sum_probs=21.1

Q ss_pred             ecCCCCHHHHHHHHHHHHHcCeEE
Q 046686           19 YDEFPSRDVFEAACDYARDRSGLQ   42 (70)
Q Consensus        19 y~~F~s~~~fe~~~~yA~~~gvLl   42 (70)
                      +..|.|++|+..+++||++.||-+
T Consensus        61 ~~~~yT~~di~elv~yA~~rgI~v   84 (311)
T cd06570          61 DGLYYTQEQIREVVAYARDRGIRV   84 (311)
T ss_pred             CCCccCHHHHHHHHHHHHHcCCEE
Confidence            456899999999999999999944


No 12 
>PF13496 DUF4120:  Domain of unknown function (DUF4120)
Probab=69.87  E-value=4.3  Score=25.85  Aligned_cols=17  Identities=12%  Similarity=0.391  Sum_probs=14.7

Q ss_pred             CHHHHHHHHHHHHHcCe
Q 046686           24 SRDVFEAACDYARDRSG   40 (70)
Q Consensus        24 s~~~fe~~~~yA~~~gv   40 (70)
                      -|+-|+.+++||+++|-
T Consensus         4 cqEhy~kvv~yA~sI~D   20 (95)
T PF13496_consen    4 CQEHYDKVVQYAESIGD   20 (95)
T ss_pred             hHHHHHHHHHHHHHhcc
Confidence            36789999999999984


No 13 
>PF08671 SinI:  Anti-repressor SinI;  InterPro: IPR010981 The SinR repressor is part of a group of Sin (sporulation inhibition) proteins in Bacillus subtilis that regulate the commitment to sporulation in response to extreme adversity []. SinR is a tetrameric repressor protein that binds to the promoters of genes essential for entry into sporulation and prevents their transcription. This repression is overcome through the activity of SinI, which disrupts the SinR tetramer through the formation of a SinI-SinR heterodimer, thereby allowing sporulation to proceed. The SinR structure consists of two domains: a dimerisation domain stabilised by a hydrophobic core, and a DNA-binding domain that is identical to domains of the bacteriophage 434 CI and Cro proteins that regulate prophage induction. The dimerisation domain is a four-helical bundle formed from two helices from the C-terminal residues of SinR and two helices from the central residues of SinI. These regions in SinR and SinI are similar in both structure and sequence. The interaction of SinR monomers to form tetramers is weaker than between SinR and SinI, since SinI can effectively disrupt SinR tetramers. This entry represents the dimerisation domain in both SinI and SinR proteins.; GO: 0005488 binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1B0N_A 2YAL_A.
Probab=68.91  E-value=8.8  Score=19.56  Aligned_cols=28  Identities=21%  Similarity=0.214  Sum_probs=20.1

Q ss_pred             HHHHHHHHHHHHcCeEEeeeCCcceEEEeccccHHHHHHHHhhc
Q 046686           26 DVFEAACDYARDRSGLQWEDSKKMRLVVKAEIHIHIREFLRGQN   69 (70)
Q Consensus        26 ~~fe~~~~yA~~~gvLlW~~~~kr~~~V~~~gh~~vr~f~k~~~   69 (70)
                      .|...+..-|++.|+-                -++||+|++.+|
T Consensus         3 ~EW~~Li~eA~~~Gls----------------~eeir~FL~~~k   30 (30)
T PF08671_consen    3 EEWVELIKEAKESGLS----------------KEEIREFLEFNK   30 (30)
T ss_dssp             HHHHHHHHHHHHTT------------------HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHcCCC----------------HHHHHHHHHhCC
Confidence            4667788888888863                388999988764


No 14 
>PF02244 Propep_M14:  Carboxypeptidase activation peptide;  InterPro: IPR003146 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  The peptidases are synthesised as inactive molecules, zymogens, with propeptides that must be removed by proteolytic cleavage to activate the enzyme. Structural studies of carboxypeptidases A and B reveal the propeptide to exist as a globular domain, followed by an extended alpha-helix; this shields the catalytic site, without specifically binding to it, while the substrate-binding site is blocked by making specific contacts [, ]. Members of this propeptide family are found in the metallocarboxypeptidases: A1, A2 [], A3, A4, A5, A6, U, insect gut carboxypeptidase and B [], and and are associated with peptidases belonging to MEROPS peptidase family M14A.  Carboxypeptidases are found in abundance in pancreatic secretions. The pro-segment moiety (activation peptide) accounts for up to a quarter of the total length of the peptidase.; GO: 0004180 carboxypeptidase activity, 0006508 proteolysis; PDB: 3D68_C 3D67_B 3D66_A 1PBA_A 3GLJ_A 1NSA_A 1KWM_A 2BOA_B 1PYT_A 1JQG_A ....
Probab=66.27  E-value=22  Score=20.08  Aligned_cols=46  Identities=13%  Similarity=0.277  Sum_probs=38.2

Q ss_pred             CCHHHHHHHHHHHHHcCeEEeeeCC---c-ceEEEeccccHHHHHHHHhh
Q 046686           23 PSRDVFEAACDYARDRSGLQWEDSK---K-MRLVVKAEIHIHIREFLRGQ   68 (70)
Q Consensus        23 ~s~~~fe~~~~yA~~~gvLlW~~~~---k-r~~~V~~~gh~~vr~f~k~~   68 (70)
                      .|.+..+.+.+.....++-.|..+.   . -.+.|+++....+.++++..
T Consensus         6 ~t~~q~~~L~~L~~~~~~dfW~~~~~~~~~~dv~V~p~~~~~f~~~L~~~   55 (74)
T PF02244_consen    6 KTEEQLELLQELEQSNELDFWKEPSSVGRPVDVMVPPEKLEEFEELLKEH   55 (74)
T ss_dssp             SSHHHHHHHHHHHHHSTEEEEESSSSTTSEEEEEEEGGGHHHHHHHHHHT
T ss_pred             CCHHHHHHHHHHhcccceeeecCCCCCCCeEEEEECHHHHHHHHHHHHHC
Confidence            4567789999999999999999887   2 36788898888899998864


No 15 
>cd06565 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins. GcnA  is an exoglucosidase which cleaves N-acetyl-beta-D-galactosamine (NAG) and N-acetyl-beta-D-galactosamine residues from 4-methylumbelliferylated (4MU) substrates, as well as cleaving NAG from chito-oligosaccharides (i.e. NAG polymers).  In contrast, sulfated forms of the substrate are unable to be cleaved and act instead as mild competitive inhibitors. Additionally, the enzyme is known to be poisoned by several first-row transition metals as well as by mercury.  GcnA forms a homodimer with subunits comprised of three domains, an N-terminal zincin-like domain, this central catalytic GH20 domain, and a C-terminal alpha helical domain.  The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
Probab=64.92  E-value=8.3  Score=28.00  Aligned_cols=23  Identities=13%  Similarity=0.036  Sum_probs=21.1

Q ss_pred             cCCCCHHHHHHHHHHHHHcCeEE
Q 046686           20 DEFPSRDVFEAACDYARDRSGLQ   42 (70)
Q Consensus        20 ~~F~s~~~fe~~~~yA~~~gvLl   42 (70)
                      ..+.|++|+..+.+||++.|+-|
T Consensus        54 ~~~yT~~ei~ei~~yA~~~gI~v   76 (301)
T cd06565          54 RGAYTKEEIREIDDYAAELGIEV   76 (301)
T ss_pred             CCCcCHHHHHHHHHHHHHcCCEE
Confidence            67889999999999999999865


No 16 
>PF00728 Glyco_hydro_20:  Glycosyl hydrolase family 20, catalytic domain;  InterPro: IPR015883 Glycoside hydrolase family 20 GH20 from CAZY comprises enzymes with several known activities; beta-hexosaminidase (3.2.1.52 from EC); lacto-N-biosidase (3.2.1.140 from EC). Carbonyl oxygen of the C-2 acetamido group of the substrate acts as the catalytic nucleophile/base in this family of enzymes. In the brain and other tissues, beta-hexosaminidase A degrades GM2 gangliosides; specifically, the enzyme hydrolyses terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides. There are 3 forms of beta-hexosaminidase: hexosaminidase A is a trimer, with one alpha, one beta-A and one beta-B chain; hexosaminidase B is a tetramer of two beta-A and two beta-B chains; and hexosaminidase S is a homodimer of alpha chains. The two beta chains are derived from the cleavage of a precursor. Mutations in the beta-chain lead to Sandhoff disease, a lysosomal storage disorder characterised by accumulation of GM2 ganglioside [].; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds; PDB: 3RPM_A 1C7T_A 1QBA_A 1QBB_A 1C7S_A 3RCN_A 2YL8_A 2YL6_A 2YLL_A 2YL5_C ....
Probab=62.21  E-value=6.4  Score=28.18  Aligned_cols=21  Identities=14%  Similarity=0.284  Sum_probs=18.6

Q ss_pred             CCCHHHHHHHHHHHHHcCeEE
Q 046686           22 FPSRDVFEAACDYARDRSGLQ   42 (70)
Q Consensus        22 F~s~~~fe~~~~yA~~~gvLl   42 (70)
                      +.|++|...+++||++.||-|
T Consensus        69 ~yT~~di~~lv~yA~~~gI~V   89 (351)
T PF00728_consen   69 YYTKEDIRELVAYAKERGIEV   89 (351)
T ss_dssp             EBEHHHHHHHHHHHHHTT-EE
T ss_pred             cCCHHHHHHHHHHHHHcCCce
Confidence            789999999999999999955


No 17 
>COG4379 Mu-like prophage tail protein gpP [General function prediction only]
Probab=56.24  E-value=19  Score=28.08  Aligned_cols=31  Identities=23%  Similarity=0.397  Sum_probs=25.6

Q ss_pred             CCHHHHHHHHHHHHHcCeEEeeeCCcceEEE
Q 046686           23 PSRDVFEAACDYARDRSGLQWEDSKKMRLVV   53 (70)
Q Consensus        23 ~s~~~fe~~~~yA~~~gvLlW~~~~kr~~~V   53 (70)
                      ++...+..+.++|+-.|+|.|.++..-.+|-
T Consensus       149 pGETa~daL~~iAr~~gll~~~e~DG~Lv~t  179 (386)
T COG4379         149 PGETAWDALTHIARHVGLLPWLEPDGTLVVT  179 (386)
T ss_pred             CcchHHHHHHHHHhhcceeEEecCCceEEEe
Confidence            4567899999999999999998887755443


No 18 
>PF03102 NeuB:  NeuB family;  InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac). It catalyses the direct formation of Neu5Ac (the most common sialic acid) by condensation of phosphoenolpyruvate (PEP) and N-acetylmannosamine (ManNAc). This reaction has only been observed in prokaryotes; eukaryotes synthesise the 9-phosphate form, Neu5Ac-9-P, and utilise ManNAc-6-P instead of ManNAc. Such eukaryotic enzymes are not present in this family []. This family also contains SpsE spore coat polysaccharide biosynthesis proteins.; GO: 0016051 carbohydrate biosynthetic process; PDB: 3G8R_B 1XUU_A 1XUZ_A 3CM4_A 2ZDR_A 1VLI_A 2WQP_A.
Probab=56.02  E-value=14  Score=26.44  Aligned_cols=24  Identities=8%  Similarity=0.117  Sum_probs=19.2

Q ss_pred             CCHHHHHHHHHHHHHcCeEEeeeC
Q 046686           23 PSRDVFEAACDYARDRSGLQWEDS   46 (70)
Q Consensus        23 ~s~~~fe~~~~yA~~~gvLlW~~~   46 (70)
                      .|.++|..+.+||+++|+..++.+
T Consensus        53 l~~e~~~~L~~~~~~~gi~f~stp   76 (241)
T PF03102_consen   53 LSEEQHKELFEYCKELGIDFFSTP   76 (241)
T ss_dssp             S-HHHHHHHHHHHHHTT-EEEEEE
T ss_pred             CCHHHHHHHHHHHHHcCCEEEECC
Confidence            578899999999999999887654


No 19 
>cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=51.10  E-value=44  Score=19.25  Aligned_cols=38  Identities=11%  Similarity=0.114  Sum_probs=27.0

Q ss_pred             CCCCHHHHHHHHHHHHHcCeEEeeeC-----Cc-ceEEEecccc
Q 046686           21 EFPSRDVFEAACDYARDRSGLQWEDS-----KK-MRLVVKAEIH   58 (70)
Q Consensus        21 ~F~s~~~fe~~~~yA~~~gvLlW~~~-----~k-r~~~V~~~gh   58 (70)
                      ...|.++.+.+++.+++.|+-+...+     .. ..+|..++||
T Consensus        77 ~v~~~~~v~~~~~~l~~~g~~~~~~~~~~~~g~~~~~~~DPdG~  120 (125)
T cd07241          77 SVGSKEAVDELTERLRADGYLIIGEPRTTGDGYYESVILDPEGN  120 (125)
T ss_pred             ECCCHHHHHHHHHHHHHCCCEEEeCceecCCCeEEEEEECCCCC
Confidence            44567899999999999998666422     22 3456668876


No 20 
>cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase. This subfamily contains the N-terminal, non-catalytic, domain of catechol 2,3-dioxygenase. Catechol 2,3-dioxygenase  (2,3-CTD, catechol:oxygen 2,3-oxidoreductase) catalyzes an extradiol cleavage of catechol to form 2-hydroxymuconate semialdehyde with the insertion of two atoms of oxygen. The enzyme is a homotetramer and contains catalytically essential Fe(II) . The reaction proceeds by an ordered bi-unit mechanism. First, catechol binds to the enzyme, this is then followed by the binding of dioxygen to form a tertiary complex, and then the aromatic ring is cleaved to produce 2-hydroxymuconate semialdehyde. Catechol 2,3-dioxygenase belongs to the type I extradiol dioxygenase family. The subunit comprises the N- and C-terminal domains of similar structure fold, resulting from an ancient gene duplication. The active site is located in a funnel-shaped space of the C-terminal domain. This subfamily represents the N-terminal do
Probab=50.17  E-value=43  Score=19.75  Aligned_cols=38  Identities=5%  Similarity=-0.221  Sum_probs=27.6

Q ss_pred             CCCCHHHHHHHHHHHHHcCeEEeeeC-------CcceEEEecccc
Q 046686           21 EFPSRDVFEAACDYARDRSGLQWEDS-------KKMRLVVKAEIH   58 (70)
Q Consensus        21 ~F~s~~~fe~~~~yA~~~gvLlW~~~-------~kr~~~V~~~gh   58 (70)
                      ...|.++.+.+.+..++.|+-+...+       .+...|-.++||
T Consensus        68 ~v~~~~dv~~~~~~l~~~G~~~~~~~~~~~~~~~~~~~~~DPdG~  112 (122)
T cd07265          68 KVLDDADLEKLEARLQAYGVAVERIPAGELPGVGRRVRFQLPSGH  112 (122)
T ss_pred             EeCCHHHHHHHHHHHHHCCCcEEEcccCCCCCCceEEEEECCCCC
Confidence            45788899999999999999765422       234555567776


No 21 
>cd01998 tRNA_Me_trans tRNA methyl transferase. This family represents tRNA(5-methylaminomethyl-2-thiouridine)-methyltransferase which is involved in the biosynthesis of the modified nucleoside 5-methylaminomethyl-2-thiouridine present in the wobble position of some tRNAs. This family of enzyme only presents in bacteria and eukaryote. The  archaeal counterpart of this enzyme performs same function, but is completely unrelated in sequence.
Probab=45.70  E-value=24  Score=26.20  Aligned_cols=37  Identities=11%  Similarity=0.093  Sum_probs=26.6

Q ss_pred             HHHHHHHHHcCeEEeeeC-CcceEEEeccccHHHHHHHHhh
Q 046686           29 EAACDYARDRSGLQWEDS-KKMRLVVKAEIHIHIREFLRGQ   68 (70)
Q Consensus        29 e~~~~yA~~~gvLlW~~~-~kr~~~V~~~gh~~vr~f~k~~   68 (70)
                      +.+++||+++|+.+|..+ +.-..||..   ...++|++.+
T Consensus       170 ~eVr~~A~~~gl~~~~k~~s~~iCFi~~---~~~~~fl~~~  207 (349)
T cd01998         170 PEVREIAKELGLPVAKKKDSQGICFIGE---RNFRDFLKEY  207 (349)
T ss_pred             HHHHHHHHHcCCCCCCCCCCCceEEecC---CCHHHHHHHh
Confidence            458999999999998654 445667754   3467777754


No 22 
>cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1.13.11.39) 1 from Rhodococcus globerulus P6 (BphC1-RGP6) and similar proteins. This subfamily contains the N-terminal, non-catalytic, domain of BphC1-RGP6 and similar proteins. BphC catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). This subfamily of BphCs belongs to the type I extradiol dioxygenase family, which require a metal in the active site in its catalytic mechanism. Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of 2,3-dihydroxybiphenyl 1,2-dioxygenases. For example, three types of BphC enzymes have been found in Rhodococcus globerulus (BphC1-RGP6 - BphC3-RGP6), all three enzymes are type I extradiol dioxygenases. BphC1-RGP6 has an internal duplication, it is a two-domain dioxygenase which forms octamers, and has Fe(II) at the catalytic site. Its N-
Probab=44.38  E-value=54  Score=19.48  Aligned_cols=38  Identities=13%  Similarity=0.058  Sum_probs=27.2

Q ss_pred             CCCCHHHHHHHHHHHHHcCeEEeeeC---------CcceEEEecccc
Q 046686           21 EFPSRDVFEAACDYARDRSGLQWEDS---------KKMRLVVKAEIH   58 (70)
Q Consensus        21 ~F~s~~~fe~~~~yA~~~gvLlW~~~---------~kr~~~V~~~gh   58 (70)
                      ...|.++.+.+++.+++.|+-+-..+         .+-..|..++||
T Consensus        64 ~v~~~~dl~~~~~~l~~~Gv~~~~~~~~~~~~~~~~~~~~~~DPdG~  110 (120)
T cd07252          64 EVADEAALDALAARLRAAGVAVEEGSAELAAERGVEGLIRFADPDGN  110 (120)
T ss_pred             EECCHHHHHHHHHHHHHcCCeEEEcCHHHHhhCCCcEEEEEECCCCC
Confidence            34667899999999999999664322         123566678886


No 23 
>PF08727 P3A:  Poliovirus 3A protein like;  InterPro: IPR014838 The 3A protein is found in positive-strand RNA viruses. It is a critical component of the poliovirus replication complex, and is also an inhibitor of host cell ER to Golgi transport. ; GO: 0003968 RNA-directed RNA polymerase activity, 0004197 cysteine-type endopeptidase activity, 0017111 nucleoside-triphosphatase activity; PDB: 1NG7_A.
Probab=41.32  E-value=15  Score=21.50  Aligned_cols=19  Identities=5%  Similarity=0.025  Sum_probs=12.0

Q ss_pred             CHHHHHHHHHHHHHcCeEE
Q 046686           24 SRDVFEAACDYARDRSGLQ   42 (70)
Q Consensus        24 s~~~fe~~~~yA~~~gvLl   42 (70)
                      +.-+=+.|++||++.|.++
T Consensus        25 ~SV~~~eV~~YC~~~GWIi   43 (57)
T PF08727_consen   25 RSVDSPEVREYCEEQGWII   43 (57)
T ss_dssp             HHH--HHHHHHHHHHT--T
T ss_pred             HhcCCHHHHHHHHHCCccc
Confidence            3344567999999999876


No 24 
>PLN02955 8-amino-7-oxononanoate synthase
Probab=41.18  E-value=49  Score=26.18  Aligned_cols=55  Identities=15%  Similarity=-0.027  Sum_probs=42.9

Q ss_pred             CceeeeceEEecCCCCHHHHHHHHHHHHHcCeEEeeeCCcceEEEeccccHHHHHH
Q 046686            9 NKDEMTRVHYYDEFPSRDVFEAACDYARDRSGLQWEDSKKMRLVVKAEIHIHIREF   64 (70)
Q Consensus         9 nRi~~~~g~Ly~~F~s~~~fe~~~~yA~~~gvLlW~~~~kr~~~V~~~gh~~vr~f   64 (70)
                      .++-.+||+ |+.-.+....+.+++.|++.|++|--|++.-..++.+.|......|
T Consensus       250 ~~~Vv~EgV-~SmdGdiapL~eL~~L~~~~ga~LiVDEAH~~Gv~G~~G~G~~e~~  304 (476)
T PLN02955        250 RKVVVTDSL-FSMDGDFAPMEELSQLRKKYGFLLVIDDAHGTFVCGENGGGVAEEF  304 (476)
T ss_pred             ceEEEEeCC-CCCCCCcCCHHHHHHHHHHcCcEEEEcccccCceecCCCCcHHHHh
Confidence            357777776 6666666678888888999999999999999889888776655543


No 25 
>cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=37.97  E-value=85  Score=18.39  Aligned_cols=37  Identities=11%  Similarity=0.077  Sum_probs=26.6

Q ss_pred             CCCHHHHHHHHHHHHHcCeEEeeeCCc---------ceEEEecccc
Q 046686           22 FPSRDVFEAACDYARDRSGLQWEDSKK---------MRLVVKAEIH   58 (70)
Q Consensus        22 F~s~~~fe~~~~yA~~~gvLlW~~~~k---------r~~~V~~~gh   58 (70)
                      .++.++.+.+.+.+++.|+-+-..+..         ...|..++|+
T Consensus        76 v~~~~d~~~~~~~l~~~g~~~~~~~~~~~~~~~~~~~~~~~DpdG~  121 (128)
T cd07242          76 APSREAVDELYARLAKRGAEILYAPREPYAGGPGYYALFFEDPDGI  121 (128)
T ss_pred             cCCHHHHHHHHHHHHHcCCeEecCCcccccCCCcEEEEEEECCCCc
Confidence            456789999999999999987764442         3344556664


No 26 
>COG1313 PflX Uncharacterized Fe-S protein PflX, homolog of pyruvate formate lyase activating proteins [General function prediction only]
Probab=37.89  E-value=34  Score=26.27  Aligned_cols=20  Identities=25%  Similarity=0.313  Sum_probs=18.0

Q ss_pred             CCCCHHHHHHHHHHHHHcCe
Q 046686           21 EFPSRDVFEAACDYARDRSG   40 (70)
Q Consensus        21 ~F~s~~~fe~~~~yA~~~gv   40 (70)
                      -.+|.++|+.+.+||+.+|.
T Consensus       310 R~lt~eE~e~a~~~a~~~gl  329 (335)
T COG1313         310 RRLTREEYEKALEYAEKLGL  329 (335)
T ss_pred             ccCCHHHHHHHHHHHHHcCC
Confidence            45899999999999999986


No 27 
>PF10087 DUF2325:  Uncharacterized protein conserved in bacteria (DUF2325);  InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=37.60  E-value=68  Score=19.16  Aligned_cols=34  Identities=6%  Similarity=-0.049  Sum_probs=26.4

Q ss_pred             eeeeceE-EecCCCCHHHHHHHHHHHHHcCeEEee
Q 046686           11 DEMTRVH-YYDEFPSRDVFEAACDYARDRSGLQWE   44 (70)
Q Consensus        11 i~~~~g~-Ly~~F~s~~~fe~~~~yA~~~gvLlW~   44 (70)
                      ++-.+.+ +..+|-|-.....+.+.|++.|+.++-
T Consensus        46 i~~aD~VIv~t~~vsH~~~~~vk~~akk~~ip~~~   80 (97)
T PF10087_consen   46 IKKADLVIVFTDYVSHNAMWKVKKAAKKYGIPIIY   80 (97)
T ss_pred             cCCCCEEEEEeCCcChHHHHHHHHHHHHcCCcEEE
Confidence            3333444 567999999999999999999987653


No 28 
>cd08351 ChaP_like ChaP, an enzyme involved in the biosynthesis of the antitumor agent chartreusin (cha); and similar proteins. ChaP is an enzyme involved in the biosynthesis of the potent antitumor agent chartreusin (cha). Cha is an aromatic polyketide glycoside produced by Streptomyces chartreusis. ChaP may play a role as a meta-cleavage dioxygenase in the oxidative rearrangement of the anthracyclic polyketide. ChaP belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases.
Probab=37.18  E-value=85  Score=18.61  Aligned_cols=21  Identities=24%  Similarity=0.390  Sum_probs=17.4

Q ss_pred             CHHHHHHHHHHHHHcCeEEee
Q 046686           24 SRDVFEAACDYARDRSGLQWE   44 (70)
Q Consensus        24 s~~~fe~~~~yA~~~gvLlW~   44 (70)
                      +.++.+.+.+.+++.|+-+..
T Consensus        67 ~~~dl~~~~~~l~~~G~~~~~   87 (123)
T cd08351          67 SEEEFDRIFARIRERGIDYWA   87 (123)
T ss_pred             CHHHHHHHHHHHHHcCCceec
Confidence            347899999999999997643


No 29 
>smart00702 P4Hc Prolyl 4-hydroxylase alpha subunit homologues. Mammalian enzymes catalyse hydroxylation of collagen, for example. Prokaryotic enzymes might catalyse hydroxylation of antibiotic peptides. These are 2-oxoglutarate-dependent dioxygenases, requiring 2-oxoglutarate and dioxygen as cosubstrates and ferrous iron as a cofactor.
Probab=37.18  E-value=49  Score=21.44  Aligned_cols=24  Identities=17%  Similarity=0.146  Sum_probs=21.6

Q ss_pred             eEEecCCCCHHHHHHHHHHHHHcC
Q 046686           16 VHYYDEFPSRDVFEAACDYARDRS   39 (70)
Q Consensus        16 g~Ly~~F~s~~~fe~~~~yA~~~g   39 (70)
                      -+++.+|.|.++-+.+.+.|+..+
T Consensus         3 i~~~~~~ls~~ec~~li~~~~~~~   26 (178)
T smart00702        3 VVVFHDFLSPAECQKLLEEAEPLG   26 (178)
T ss_pred             EEEECCCCCHHHHHHHHHHhhhhc
Confidence            468899999999999999999876


No 30 
>cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=36.07  E-value=83  Score=17.68  Aligned_cols=33  Identities=12%  Similarity=0.094  Sum_probs=23.3

Q ss_pred             HHHHHHHHHHHHcCeEEeeeC-----CcceEEEecccc
Q 046686           26 DVFEAACDYARDRSGLQWEDS-----KKMRLVVKAEIH   58 (70)
Q Consensus        26 ~~fe~~~~yA~~~gvLlW~~~-----~kr~~~V~~~gh   58 (70)
                      ++++.+++.+++.|+-+-..+     .+...+..++|+
T Consensus        76 ~di~~~~~~l~~~g~~~~~~~~~~~~~~~~~~~DP~G~  113 (119)
T cd07263          76 DDIDATYEELKARGVEFSEEPREMPYGTVAVFRDPDGN  113 (119)
T ss_pred             hHHHHHHHHHHhCCCEEeeccccCCCceEEEEECCCCC
Confidence            679999999999998766444     233445556665


No 31 
>cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The structure of this family is a that of a strand-swapped dimer.
Probab=35.32  E-value=52  Score=18.98  Aligned_cols=34  Identities=15%  Similarity=-0.145  Sum_probs=24.2

Q ss_pred             HHHHHHHHHHHHHcCeEEeeeCC------cceEEEecccc
Q 046686           25 RDVFEAACDYARDRSGLQWEDSK------KMRLVVKAEIH   58 (70)
Q Consensus        25 ~~~fe~~~~yA~~~gvLlW~~~~------kr~~~V~~~gh   58 (70)
                      .++.+.+.+.+++.|+-+...+.      +...|..++||
T Consensus        65 v~d~~~~~~~l~~~G~~~~~~~~~~~~g~~~~~~~DP~Gn  104 (112)
T cd07238          65 VDDVDAALARAVAAGFAIVYGPTDEPWGVRRFFVRDPFGK  104 (112)
T ss_pred             eCCHHHHHHHHHhcCCeEecCCccCCCceEEEEEECCCCC
Confidence            35688999999999998776553      23345567776


No 32 
>PF09286 Pro-kuma_activ:  Pro-kumamolisin, activation domain ;  InterPro: IPR015366 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This domain is found at the N terminus of peptidases belonging to MEROPS peptidase family S53 (sedolisin, clan SB). The domain adopts a ferredoxin-like fold, with an alpha+beta sandwich. Cleavage of the domain results in activation of the peptidase []. ; GO: 0008236 serine-type peptidase activity; PDB: 1T1E_A 3EDY_A 3EE6_A.
Probab=34.94  E-value=1.2e+02  Score=19.19  Aligned_cols=32  Identities=13%  Similarity=0.063  Sum_probs=23.6

Q ss_pred             CHHHHHHHHHHHHHcCeEEee-eCCcceEEEec
Q 046686           24 SRDVFEAACDYARDRSGLQWE-DSKKMRLVVKA   55 (70)
Q Consensus        24 s~~~fe~~~~yA~~~gvLlW~-~~~kr~~~V~~   55 (70)
                      +.++.+.+.+|.++.|+-... +.....+.|+.
T Consensus        60 ~~~~v~~V~~wL~~~G~~~~~~~~~~~~i~~~~   92 (143)
T PF09286_consen   60 SPEDVAAVKSWLKSHGLTVVEVSANGDWITVSG   92 (143)
T ss_dssp             -HHHHHHHHHHHHHCT-EEEEEETTTTEEEEEE
T ss_pred             CHHHHHHHHHHHHHcCCceeEEeCCCCEEEEEE
Confidence            455678899999999998876 77777777753


No 33 
>cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=34.65  E-value=83  Score=18.17  Aligned_cols=35  Identities=6%  Similarity=-0.021  Sum_probs=25.2

Q ss_pred             HHHHHHHHHHHHHcCeEEeeeCC----------cceEEEeccccH
Q 046686           25 RDVFEAACDYARDRSGLQWEDSK----------KMRLVVKAEIHI   59 (70)
Q Consensus        25 ~~~fe~~~~yA~~~gvLlW~~~~----------kr~~~V~~~gh~   59 (70)
                      .++.+.+.+.+++.|+-+-..+.          +..+|..++||.
T Consensus        75 ~~dv~~~~~~l~~~g~~~~~~p~~~~~~~~~~~~~~~~~DPdG~~  119 (125)
T cd08357          75 EEEFDALAERLEAAGVEFLIEPYTRFEGQPGEQETFFLKDPSGNA  119 (125)
T ss_pred             HHHHHHHHHHHHHCCCcEecCcceeccCCcCceeEEEEECCCCCE
Confidence            48999999999999996543221          345566688873


No 34 
>PF13344 Hydrolase_6:  Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A ....
Probab=34.59  E-value=41  Score=20.45  Aligned_cols=17  Identities=12%  Similarity=0.106  Sum_probs=7.9

Q ss_pred             cceEEEeccccHHHHHH
Q 046686           48 KMRLVVKAEIHIHIREF   64 (70)
Q Consensus        48 kr~~~V~~~gh~~vr~f   64 (70)
                      ++.+|+|.+....-.++
T Consensus        31 ~~~~~lTNns~~s~~~~   47 (101)
T PF13344_consen   31 KPVVFLTNNSSRSREEY   47 (101)
T ss_dssp             SEEEEEES-SSS-HHHH
T ss_pred             CCEEEEeCCCCCCHHHH
Confidence            55666665554333333


No 35 
>PRK00143 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed
Probab=34.14  E-value=38  Score=25.14  Aligned_cols=37  Identities=11%  Similarity=0.076  Sum_probs=26.4

Q ss_pred             HHHHHHHHHcCeEEeeeCCcc-eEEEeccccHHHHHHHHhh
Q 046686           29 EAACDYARDRSGLQWEDSKKM-RLVVKAEIHIHIREFLRGQ   68 (70)
Q Consensus        29 e~~~~yA~~~gvLlW~~~~kr-~~~V~~~gh~~vr~f~k~~   68 (70)
                      +.+++||++.|+-.|..+... .-|+..   ..+++|++..
T Consensus       169 ~eVr~~A~~~gl~~~~k~~s~~icf~~~---~~~~~fl~~~  206 (346)
T PRK00143        169 PEVREIAEEAGLPVAKKKDSQGICFIGE---RDYRDFLKRY  206 (346)
T ss_pred             HHHHHHHHHcCCCcCCCCCCCcccCCCc---hhHHHHHHHh
Confidence            468999999999888666654 445543   4678887753


No 36 
>PRK09480 slmA division inhibitor protein; Provisional
Probab=33.66  E-value=15  Score=23.54  Aligned_cols=24  Identities=25%  Similarity=0.534  Sum_probs=17.8

Q ss_pred             ceeeeceEEecCCCCHHH-HHHHHH
Q 046686           10 KDEMTRVHYYDEFPSRDV-FEAACD   33 (70)
Q Consensus        10 Ri~~~~g~Ly~~F~s~~~-fe~~~~   33 (70)
                      +...++|.+|.-|+|.++ |..+++
T Consensus        39 ~agvs~gt~Y~~F~~K~~L~~~v~~   63 (194)
T PRK09480         39 RVGVSEAALYRHFPSKARMFEGLIE   63 (194)
T ss_pred             HhCCCHhHHHHHCCCHHHHHHHHHH
Confidence            445678999999999876 555544


No 37 
>PF02836 Glyco_hydro_2_C:  Glycosyl hydrolases family 2, TIM barrel domain;  InterPro: IPR006103 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 2 GH2 from CAZY comprises enzymes with several known activities; beta-galactosidase (3.2.1.23 from EC); beta-mannosidase (3.2.1.25 from EC); beta-glucuronidase (3.2.1.31 from EC). These enzymes contain a conserved glutamic acid residue which has been shown [], in Escherichia coli lacZ (P00722 from SWISSPROT), to be the general acid/base catalyst in the active site of the enzyme. Beta-galactosidase from E. coli has a TIM-barrel-like core surrounded by four other largely beta domains [].; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 3CMG_A 3FN9_C 1YQ2_A 3K4D_B 3LPG_B 3LPF_A 3K4A_B 3K46_B 3GM8_A 3DEC_A ....
Probab=33.45  E-value=41  Score=23.78  Aligned_cols=18  Identities=17%  Similarity=0.311  Sum_probs=12.7

Q ss_pred             HHHHHHHHHcCeEEeeeC
Q 046686           29 EAACDYARDRSGLQWEDS   46 (70)
Q Consensus        29 e~~~~yA~~~gvLlW~~~   46 (70)
                      +...+.|.++|+|+|...
T Consensus        62 ~~~~~~cD~~GilV~~e~   79 (298)
T PF02836_consen   62 PRFYDLCDELGILVWQEI   79 (298)
T ss_dssp             HHHHHHHHHHT-EEEEE-
T ss_pred             HHHHHHHhhcCCEEEEec
Confidence            345678999999999664


No 38 
>PRK11675 LexA regulated protein; Provisional
Probab=32.89  E-value=46  Score=20.92  Aligned_cols=18  Identities=22%  Similarity=0.242  Sum_probs=15.7

Q ss_pred             CCHHHHHHHHHHHHHcCe
Q 046686           23 PSRDVFEAACDYARDRSG   40 (70)
Q Consensus        23 ~s~~~fe~~~~yA~~~gv   40 (70)
                      .+.+.|+.+.+||++.|+
T Consensus        57 ldedl~ekL~eyAe~~ni   74 (90)
T PRK11675         57 LNADLVDALNELAEARNI   74 (90)
T ss_pred             ECHHHHHHHHHHHHHcCC
Confidence            367889999999999886


No 39 
>PF09756 DDRGK:  DDRGK domain;  InterPro: IPR019153  This is a family of proteins of approximately 300 residues. They contain a highly conserved DDRGK motif. The function is unknown. ; PDB: 1WI9_A.
Probab=32.61  E-value=23  Score=24.79  Aligned_cols=24  Identities=13%  Similarity=0.278  Sum_probs=4.2

Q ss_pred             eCCcceEEEeccccHHHHHHHHhh
Q 046686           45 DSKKMRLVVKAEIHIHIREFLRGQ   68 (70)
Q Consensus        45 ~~~kr~~~V~~~gh~~vr~f~k~~   68 (70)
                      |+..+.+.||++-.+.|..||+.+
T Consensus       148 DdrGkfIyIs~eE~~~va~fi~~r  171 (188)
T PF09756_consen  148 DDRGKFIYISEEEMEAVAKFIKQR  171 (188)
T ss_dssp             -TT--EEE----------------
T ss_pred             cCCCCeEEecHHHHHHHHHHHHHc
Confidence            667789999999999999999875


No 40 
>cd08345 Fosfomycin_RP Fosfomycin resistant protein; inhibits the biological function of fosfomycin. This family contains three types of fosfomycin resistant protein. Fosfomycin inhibits the enzyme UDP-N-acetylglucosamine-3-enolpyruvyltransferase (MurA), which catalyzes the first committed step in bacterial cell wall biosynthesis. The three types of fosfomycin resistance proteins, employ different mechanisms to render fosfomycin [(1R,2S)-epoxypropylphosphonic acid] inactive. FosB catalyzes the addition of L-cysteine to the epoxide ring of fosfomycin. FosX catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1. FosA catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive. Catalytic activities of both FosX and FosA are Mn(II)-dependent, but FosB is activated by Mg(II). Fosfomycin resistant proteins are evolutionarily related to glyoxalase I and type I extradiol dioxygenases.
Probab=32.34  E-value=86  Score=17.87  Aligned_cols=33  Identities=6%  Similarity=0.020  Sum_probs=23.7

Q ss_pred             HHHHHHHHHHHHcCeEEeee------CCcceEEEecccc
Q 046686           26 DVFEAACDYARDRSGLQWED------SKKMRLVVKAEIH   58 (70)
Q Consensus        26 ~~fe~~~~yA~~~gvLlW~~------~~kr~~~V~~~gh   58 (70)
                      ++.+.+.+.+++.|+-+...      ..+...|..++|+
T Consensus        66 ~d~~~~~~~l~~~G~~~~~~~~~~~~~~~~~~~~DPdG~  104 (113)
T cd08345          66 EEFDEYTERLKALGVEMKPERPRVQGEGRSIYFYDPDGH  104 (113)
T ss_pred             HHHHHHHHHHHHcCCccCCCccccCCCceEEEEECCCCC
Confidence            68999999999999987643      1234445557775


No 41 
>PF05954 Phage_GPD:  Phage late control gene D protein (GPD); PDB: 2P5Z_X 3D37_A 1WRU_A 3CDD_E.
Probab=32.13  E-value=90  Score=21.24  Aligned_cols=33  Identities=12%  Similarity=-0.025  Sum_probs=22.8

Q ss_pred             CCHHHHHHHHHHHHHcCeEEeeeCCcceEEEec
Q 046686           23 PSRDVFEAACDYARDRSGLQWEDSKKMRLVVKA   55 (70)
Q Consensus        23 ~s~~~fe~~~~yA~~~gvLlW~~~~kr~~~V~~   55 (70)
                      .+..||+-+..-|++.|+.+|-+.....+++..
T Consensus       120 ~~ESD~~Fl~Rla~~~G~~~~~~~~d~~lv~~~  152 (292)
T PF05954_consen  120 YNESDWDFLQRLAEREGIWFYFDHDDGTLVFFD  152 (292)
T ss_dssp             TT-BHHHHHHHHHHHTT-EEEEECETSEEEEES
T ss_pred             cCchHHHHHHHHHHhcCcEEEEecCcceEEEec
Confidence            567899999999999999999544104455554


No 42 
>smart00348 IRF interferon regulatory factor. interferon regulatory factor, also known as trytophan pentad repeat
Probab=31.63  E-value=40  Score=21.47  Aligned_cols=17  Identities=41%  Similarity=0.794  Sum_probs=14.3

Q ss_pred             cCeEEeeeCCcceEEEe
Q 046686           38 RSGLQWEDSKKMRLVVK   54 (70)
Q Consensus        38 ~gvLlW~~~~kr~~~V~   54 (70)
                      ...|.|.|++|++|-|.
T Consensus        15 ypGL~W~d~ekt~FrIP   31 (107)
T smart00348       15 YPGLCWEDEEKTRFRIP   31 (107)
T ss_pred             CCCceEecCCCCEEEec
Confidence            34599999999999885


No 43 
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins. This subfamily contains the N-terminal, non-catalytic, domain of Burkholderia sp. NF100 MhqB and similar proteins. MhqB is a type I extradiol dioxygenase involved in the catabolism of methylhydroquinone, an intermediate in the degradation of fenitrothion. The purified enzyme has shown extradiol ring cleavage activity toward 3-methylcatechol. Fe2+ was suggested as a cofactor, the same as most other enzymes in the family. Burkholderia sp. NF100 MhqB is encoded on the plasmid pNF1. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=30.92  E-value=1e+02  Score=17.95  Aligned_cols=36  Identities=8%  Similarity=-0.104  Sum_probs=26.3

Q ss_pred             CHHHHHHHHHHHHHcCeEEeeeC----CcceEEEeccccH
Q 046686           24 SRDVFEAACDYARDRSGLQWEDS----KKMRLVVKAEIHI   59 (70)
Q Consensus        24 s~~~fe~~~~yA~~~gvLlW~~~----~kr~~~V~~~gh~   59 (70)
                      +.++++.+++.+++.|+-+...+    .....|..++||.
T Consensus        64 ~~~d~~~~~~~l~~~Gi~~~~~~~~~~~~~~~~~DP~Gn~  103 (112)
T cd08344          64 FEDDFAAFARHLEAAGVALAAAPPGADPDGVWFRDPDGNL  103 (112)
T ss_pred             EhhhHHHHHHHHHHcCCceecCCCcCCCCEEEEECCCCCE
Confidence            36889999999999999765432    1346667788873


No 44 
>cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione. Glyoxalase I (also known as lactoylglutathione lyase; EC 4.4.1.5) is part of the glyoxalase system, a two-step system for detoxifying methylglyoxal, a side product of glycolysis. This system is responsible for the conversion of reactive, acyclic alpha-oxoaldehydes into the corresponding alpha-hydroxyacids and involves 2 enzymes, glyoxalase I and II. Glyoxalase I catalyses an intramolecular redox reaction of the hemithioacetal (formed from methylglyoxal and glutathione) to form the thioester, S-D-lactoylglutathione. This reaction involves the transfer of two hydrogen atoms from C1 to C2 of the methylglyoxal, and proceeds via an ene-diol intermediate. Glyoxalase I has a requirement for bound metal ions for catalysis. Eukaryotic glyoxalase I prefers the divalent cation zinc as cofactor, whereas Escherichia coil and other prokaryotic gly
Probab=30.90  E-value=78  Score=18.17  Aligned_cols=33  Identities=15%  Similarity=0.053  Sum_probs=22.9

Q ss_pred             HHHHHHHHHHHHcCeEEeeeCC----cc-eEEEecccc
Q 046686           26 DVFEAACDYARDRSGLQWEDSK----KM-RLVVKAEIH   58 (70)
Q Consensus        26 ~~fe~~~~yA~~~gvLlW~~~~----kr-~~~V~~~gh   58 (70)
                      .+++.+++.+++.|+-+-..+.    .+ ..|..++||
T Consensus        79 ~did~~~~~l~~~G~~~~~~~~~~~~~~~~~~~DpdG~  116 (121)
T cd07233          79 DDVYAACERLEEMGVEVTKPPGDGGMKGIAFIKDPDGY  116 (121)
T ss_pred             CCHHHHHHHHHHCCCEEeeCCccCCCceEEEEECCCCC
Confidence            3488999999999996654433    33 355667776


No 45 
>cd08354 Glo_EDI_BRP_like_13 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=30.25  E-value=95  Score=17.83  Aligned_cols=37  Identities=3%  Similarity=-0.061  Sum_probs=25.5

Q ss_pred             CCCCHHHHHHHHHHHHHcCeEEeeeC-----CcceEEEecccc
Q 046686           21 EFPSRDVFEAACDYARDRSGLQWEDS-----KKMRLVVKAEIH   58 (70)
Q Consensus        21 ~F~s~~~fe~~~~yA~~~gvLlW~~~-----~kr~~~V~~~gh   58 (70)
                      .+.+ ++.+.+.+.+.+.|+-+-...     .+.+.|..++|+
T Consensus        74 ~v~~-~dl~~~~~~l~~~g~~~~~~~~~~~~~~~~~~~DP~G~  115 (122)
T cd08354          74 AIPA-EELAEWEAHLEAKGVAIESEVQWPRGGRSLYFRDPDGN  115 (122)
T ss_pred             EcCH-HHHHHHHHHHHhcCCceeccccCCCCeeEEEEECCCCC
Confidence            4566 899999999999998543322     244555567775


No 46 
>PRK00767 transcriptional regulator BetI; Validated
Probab=30.00  E-value=18  Score=23.20  Aligned_cols=26  Identities=15%  Similarity=0.042  Sum_probs=19.4

Q ss_pred             eeeeceEEecCCCCHHH-HHHHHHHHH
Q 046686           11 DEMTRVHYYDEFPSRDV-FEAACDYAR   36 (70)
Q Consensus        11 i~~~~g~Ly~~F~s~~~-fe~~~~yA~   36 (70)
                      .-.+.|.||.-|+|.++ |..+.++..
T Consensus        39 aGvs~gslY~~F~~Ke~L~~~~l~~~~   65 (197)
T PRK00767         39 AGVSTGIISHYFGGKDGLLEATMRHLL   65 (197)
T ss_pred             hCCCHHHHHHHhCCHHHHHHHHHHHHH
Confidence            45678999999999877 666666543


No 47 
>PRK10668 DNA-binding transcriptional repressor AcrR; Provisional
Probab=29.73  E-value=28  Score=22.90  Aligned_cols=25  Identities=20%  Similarity=0.304  Sum_probs=19.6

Q ss_pred             eeeeceEEecCCCCHHH-HHHHHHHH
Q 046686           11 DEMTRVHYYDEFPSRDV-FEAACDYA   35 (70)
Q Consensus        11 i~~~~g~Ly~~F~s~~~-fe~~~~yA   35 (70)
                      .-.++|.||.-|+|.++ |..+++..
T Consensus        41 agvs~~tlY~~F~sKe~Ll~~v~~~~   66 (215)
T PRK10668         41 AGVTRGAIYWHFKNKSDLFSEIWELS   66 (215)
T ss_pred             hCCChHHHHHHCCCHHHHHHHHHHHH
Confidence            45678999999999877 77777553


No 48 
>PRK07534 methionine synthase I; Validated
Probab=29.53  E-value=1.1e+02  Score=22.81  Aligned_cols=32  Identities=13%  Similarity=0.081  Sum_probs=28.5

Q ss_pred             eceEEecCCCCHHHHHHHHHHHHHcCeEEeee
Q 046686           14 TRVHYYDEFPSRDVFEAACDYARDRSGLQWED   45 (70)
Q Consensus        14 ~~g~Ly~~F~s~~~fe~~~~yA~~~gvLlW~~   45 (70)
                      -+.+++.-|+|..|-..++..+++.|.-+|-+
T Consensus       145 vD~l~~ET~p~l~E~~a~~~~~~~~~~Pv~vS  176 (336)
T PRK07534        145 ADVLWVETISAPEEIRAAAEAAKLAGMPWCGT  176 (336)
T ss_pred             CCEEEEeccCCHHHHHHHHHHHHHcCCeEEEE
Confidence            37789999999999999999999999888853


No 49 
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism]
Probab=28.93  E-value=1.1e+02  Score=21.89  Aligned_cols=35  Identities=9%  Similarity=-0.072  Sum_probs=30.0

Q ss_pred             eceEEec--CCCCHHHHHHHHHHHHHcCeEEeeeCCc
Q 046686           14 TRVHYYD--EFPSRDVFEAACDYARDRSGLQWEDSKK   48 (70)
Q Consensus        14 ~~g~Ly~--~F~s~~~fe~~~~yA~~~gvLlW~~~~k   48 (70)
                      +++++.+  +|.+.+--+.+.+-|.++|+.++..--.
T Consensus        83 ~~~v~IDEaQF~~~~~v~~l~~lad~lgi~Vi~~GL~  119 (201)
T COG1435          83 VDCVLIDEAQFFDEELVYVLNELADRLGIPVICYGLD  119 (201)
T ss_pred             cCEEEEehhHhCCHHHHHHHHHHHhhcCCEEEEeccc
Confidence            5678887  8999999999999999999999976543


No 50 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=28.83  E-value=45  Score=22.55  Aligned_cols=21  Identities=24%  Similarity=0.333  Sum_probs=17.0

Q ss_pred             eEEecCCCCHHHHHHHHHHHH
Q 046686           16 VHYYDEFPSRDVFEAACDYAR   36 (70)
Q Consensus        16 g~Ly~~F~s~~~fe~~~~yA~   36 (70)
                      +.+|++|.+.++|+..++-++
T Consensus       128 a~~~~~f~~~~~~~~~~~~~~  148 (154)
T PRK00464        128 ASVYRSFKDVDDFEEEIEELA  148 (154)
T ss_pred             hhhcCCCCCHHHHHHHHHHHH
Confidence            468999999999998776543


No 51 
>cd00531 NTF2_like Nuclear transport factor 2 (NTF2-like) superfamily. This family includes members of the NTF2 family, Delta-5-3-ketosteroid isomerases, Scytalone Dehydratases, and the beta subunit of Ring hydroxylating dioxygenases. This family is a classic example of divergent evolution wherein the proteins have many common structural details but diverge greatly in their function. For example,  nuclear transport factor 2 (NTF2) mediates the nuclear import of RanGDP and  binds to both RanGDP and FxFG repeat-containing nucleoporins while Ketosteroid isomerases catalyze the isomerization of delta-5-3-ketosteroid to delta-4-3-ketosteroid, by intramolecular transfer of the C4-beta proton to the C6-beta position. While the function of the beta sub-unit of the Ring hydroxylating dioxygenases is not known, Scytalone Dehydratases catalyzes two reactions in the biosynthetic pathway that produces fungal melanin. Members of the NTF2-like superfamily are widely distributed among bacteria, archaea
Probab=28.82  E-value=62  Score=18.05  Aligned_cols=42  Identities=12%  Similarity=-0.046  Sum_probs=26.0

Q ss_pred             HHHHHHHHHHHHHcCeEEeeeCCcceEEEeccccHHHHHHHHhh
Q 046686           25 RDVFEAACDYARDRSGLQWEDSKKMRLVVKAEIHIHIREFLRGQ   68 (70)
Q Consensus        25 ~~~fe~~~~yA~~~gvLlW~~~~kr~~~V~~~gh~~vr~f~k~~   68 (70)
                      +.+.+.+..+..+-+++.+....  .+.....|++.|++|+...
T Consensus        14 ~~~~~~l~~~~~~d~~~~~~~~~--~~~~~~~g~~~i~~~~~~~   55 (124)
T cd00531          14 AGDREWLALLYADDAYFEPPGGD--GLIYPDDGREAIEDRVRRL   55 (124)
T ss_pred             CchHHHHHhhCcCcEEEEEccCC--EEEEcCChHHHHHHHHHhc
Confidence            45566666666666666654332  2334457899999998753


No 52 
>cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins. 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC) catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). The enzyme contains a N-terminal and a C-terminal domain of similar structure fold, resulting from an ancient gene duplication. BphC belongs to the type I extradiol dioxygenase family, which requires a metal in the active site for its catalytic activity. Polychlorinated biphenyl degrading bacteria demonstrate multiplicity of BphCs. Bacterium Rhodococcus rhodochrous K37 has eight genes encoding BphC enzymes. This family includes the N-terminal domain of BphC5-RrK37. The crystal structure of the protein from Novosphingobium aromaticivorans has a Mn(II)in the active site, although most proteins of type I extradiol dioxyge
Probab=28.55  E-value=1.2e+02  Score=17.38  Aligned_cols=37  Identities=14%  Similarity=0.048  Sum_probs=25.9

Q ss_pred             CCCHHHHHHHHHHHHHcCeEEeeeC--------CcceEEEecccc
Q 046686           22 FPSRDVFEAACDYARDRSGLQWEDS--------KKMRLVVKAEIH   58 (70)
Q Consensus        22 F~s~~~fe~~~~yA~~~gvLlW~~~--------~kr~~~V~~~gh   58 (70)
                      -.+.++.+.+.+.+++.|+-+-..+        .....|..++||
T Consensus        66 v~~~~~l~~~~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~DP~G~  110 (120)
T cd08362          66 VASRADVDALARQVAARGGTVLSEPGATDDPGGGYGFRFFDPDGR  110 (120)
T ss_pred             eCCHHHHHHHHHHHHHcCCceecCCcccCCCCCceEEEEECCCCC
Confidence            3567899999999999999543222        223566678876


No 53 
>PLN00052 prolyl 4-hydroxylase; Provisional
Probab=28.50  E-value=57  Score=24.30  Aligned_cols=24  Identities=21%  Similarity=0.379  Sum_probs=21.2

Q ss_pred             ceEEecCCCCHHHHHHHHHHHHHc
Q 046686           15 RVHYYDEFPSRDVFEAACDYARDR   38 (70)
Q Consensus        15 ~g~Ly~~F~s~~~fe~~~~yA~~~   38 (70)
                      --++|.+|.|.+|-+.+.+.|+..
T Consensus        55 ~i~~~~nfLs~~Ecd~Li~la~~~   78 (310)
T PLN00052         55 RIFVYKGFLSDAECDHLVKLAKKK   78 (310)
T ss_pred             CEEEECCcCCHHHHHHHHHhcccc
Confidence            358999999999999999999864


No 54 
>COG3525 Chb N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism]
Probab=27.60  E-value=60  Score=27.38  Aligned_cols=25  Identities=20%  Similarity=0.178  Sum_probs=22.9

Q ss_pred             EecCCCCHHHHHHHHHHHHHcCeEE
Q 046686           18 YYDEFPSRDVFEAACDYARDRSGLQ   42 (70)
Q Consensus        18 Ly~~F~s~~~fe~~~~yA~~~gvLl   42 (70)
                      ++..|-|+++...+++||.+.++.+
T Consensus       338 ~~ggfytqd~~relv~yAsar~Itv  362 (732)
T COG3525         338 RMGGFYTQDDIRELVAYASARQITV  362 (732)
T ss_pred             cccCcccHHHHHHHHHHHhhcCcee
Confidence            5789999999999999999999876


No 55 
>TIGR00789 flhB_rel flhB C-terminus-related protein. This model describes a short protein (80-93 residues) homologous to the C-terminus of the flagellar biosynthetic protein FlhB. It is found so far only in species that also have FlhB. In a phylogenetic tree based on alignment of both this family and the homologous region of FlhB and its homologs, the members of this family form a monophyletic set.
Probab=27.21  E-value=47  Score=20.17  Aligned_cols=19  Identities=21%  Similarity=0.136  Sum_probs=16.7

Q ss_pred             HHHHHHHHHcCeEEeeeCC
Q 046686           29 EAACDYARDRSGLQWEDSK   47 (70)
Q Consensus        29 e~~~~yA~~~gvLlW~~~~   47 (70)
                      +.+++.|++.||.+.+|+.
T Consensus        30 ~~I~~~A~e~~VPi~~~~~   48 (82)
T TIGR00789        30 ERIIEIAKKHGIPIVEDPD   48 (82)
T ss_pred             HHHHHHHHHcCCCEEeCHH
Confidence            5689999999999999874


No 56 
>COG2154 Pterin-4a-carbinolamine dehydratase [Coenzyme metabolism]
Probab=26.90  E-value=85  Score=20.06  Aligned_cols=54  Identities=20%  Similarity=0.292  Sum_probs=39.4

Q ss_pred             cccccCceeeeceEEecCCCCHHHHH-HHHHHHHHcCe-EEeeeCCcceEEEecccc
Q 046686            4 WESDLNKDEMTRVHYYDEFPSRDVFE-AACDYARDRSG-LQWEDSKKMRLVVKAEIH   58 (70)
Q Consensus         4 We~ErnRi~~~~g~Ly~~F~s~~~fe-~~~~yA~~~gv-LlW~~~~kr~~~V~~~gh   58 (70)
                      |++..++.+.+..|-|++|...-.|- .+...|+++|- .-|++.-+ .+.|+-.-|
T Consensus        21 W~l~~~~~~l~r~f~FknF~~a~~F~~~vA~~Ae~~~HHPdi~~~y~-~V~vtltTH   76 (101)
T COG2154          21 WELADDGAKLTRTFKFKNFKQAIAFVNRVAEIAEKLNHHPDIEVVYN-RVTVTLTTH   76 (101)
T ss_pred             CEEecCcceEEEEEEcCCHHHHHHHHHHHHHHHHHhCCCCCeEEEee-eEEEEEEEc
Confidence            99999999999999999999888875 56778888875 44444444 344443333


No 57 
>PF00464 SHMT:  Serine hydroxymethyltransferase;  InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) []. The pyridoxal-P group is attached to a lysine residue around which the sequence is highly conserved in all forms of the enzyme []. The enzyme carries out interconversion of serine and glycine using PLP as the cofactor. SHMT catalyses the transfer of a hydroxymethyl group from N5, N10- methylene tetrahydrofolate to glycine, resulting in the formation of serine and tetrahydrofolate. Both eukaryotic and prokaryotic SHMT enzymes form tight obligate homodimers and the mammalian enzyme forms a homotetramer [, ]. PLP dependent enzymes were previously classified into alpha, beta and gamma classes, based on the chemical characteristics (carbon atom involved) of the reaction they catalysed. The availability of several structures allowed a comprehensive analysis of the evolutionary classification of PLP dependent enzymes, and it was found that the functional classification did not always agree with the evolutionary history of these enzymes. Structure and sequence analysis has revealed that the PLP dependent enzymes can be classified into four major groups of different evolutionary origin: aspartate aminotransferase superfamily (fold type I), tryptophan synthase beta superfamily (fold type II), alanine racemase superfamily (fold type III), D-amino acid superfamily (fold type IV) and glycogen phophorylase family (fold type V) [, ]. In vertebrates, glycine hydroxymethyltransferase exists in a cytoplasmic and a mitochondrial form whereas only one form is found in prokaryotes.; GO: 0004372 glycine hydroxymethyltransferase activity, 0006544 glycine metabolic process, 0006563 L-serine metabolic process; PDB: 3GBX_B 3H7F_A 1YJS_A 2VMW_A 2W7H_A 2W7E_A 2VMY_B 2W7L_A 2VMZ_A 2VMS_A ....
Probab=26.74  E-value=94  Score=24.03  Aligned_cols=29  Identities=14%  Similarity=0.179  Sum_probs=20.2

Q ss_pred             cCCCCHHHHHHHHHHHHHcCeEEeeeCCc
Q 046686           20 DEFPSRDVFEAACDYARDRSGLQWEDSKK   48 (70)
Q Consensus        20 ~~F~s~~~fe~~~~yA~~~gvLlW~~~~k   48 (70)
                      +.++-.-+|+.+++.|.+.|.+||-|-+.
T Consensus       178 S~y~~~~d~~~~reIad~vga~l~~D~sH  206 (399)
T PF00464_consen  178 SSYPRPIDFKRFREIADEVGAYLMADISH  206 (399)
T ss_dssp             SSTSS---HHHHHHHHHHTT-EEEEE-TT
T ss_pred             hhccCccCHHHHHHHHHhcCcEEEecccc
Confidence            34566789999999999999999988754


No 58 
>PF15252 DUF4589:  Domain of unknown function (DUF4589)
Probab=26.56  E-value=31  Score=25.07  Aligned_cols=17  Identities=6%  Similarity=0.102  Sum_probs=14.7

Q ss_pred             ccCceeeeceEEecCCC
Q 046686            7 DLNKDEMTRVHYYDEFP   23 (70)
Q Consensus         7 ErnRi~~~~g~Ly~~F~   23 (70)
                      .|+|++|.+-|||..+=
T Consensus       130 tRERVRFSdKVlYHalC  146 (221)
T PF15252_consen  130 TRERVRFSDKVLYHALC  146 (221)
T ss_pred             ccceeeccccceeeeee
Confidence            58999999999997654


No 59 
>KOG2230 consensus Predicted beta-mannosidase [Carbohydrate transport and metabolism]
Probab=26.54  E-value=28  Score=29.31  Aligned_cols=32  Identities=28%  Similarity=0.377  Sum_probs=22.8

Q ss_pred             ccCceeeeceEEecCCCCHHHHHHHHHHHHHcCeEEeee
Q 046686            7 DLNKDEMTRVHYYDEFPSRDVFEAACDYARDRSGLQWED   45 (70)
Q Consensus         7 ErnRi~~~~g~Ly~~F~s~~~fe~~~~yA~~~gvLlW~~   45 (70)
                      -+|=++...|=.|.   | +.|   -.+|.++|+|+|.|
T Consensus       370 ~MN~lRVWGGGvYE---s-d~F---Y~lad~lGilVWQD  401 (867)
T KOG2230|consen  370 GMNMLRVWGGGVYE---S-DYF---YQLADSLGILVWQD  401 (867)
T ss_pred             CcceEEEecCcccc---c-hhH---HHHhhhccceehhh
Confidence            45677777887774   2 222   35799999999976


No 60 
>PRK11202 DNA-binding transcriptional repressor FabR; Provisional
Probab=26.14  E-value=40  Score=22.39  Aligned_cols=25  Identities=16%  Similarity=0.224  Sum_probs=18.5

Q ss_pred             ceeeeceEEecCCCCHHH-HHHHHHH
Q 046686           10 KDEMTRVHYYDEFPSRDV-FEAACDY   34 (70)
Q Consensus        10 Ri~~~~g~Ly~~F~s~~~-fe~~~~y   34 (70)
                      +...++|.+|.-|+|.++ |..+++.
T Consensus        41 ~Agvs~~t~Y~hF~sKe~L~~av~~~   66 (203)
T PRK11202         41 EAGIAPTSFYRHFRDMDELGLTMVDE   66 (203)
T ss_pred             HhCCCcchHHHHCCCHHHHHHHHHHH
Confidence            345789999999999877 5555443


No 61 
>PF13707 RloB:  RloB-like protein
Probab=26.13  E-value=1.2e+02  Score=19.63  Aligned_cols=23  Identities=17%  Similarity=0.173  Sum_probs=19.4

Q ss_pred             CHHHHHHHHHHHHHcCe-EEeeeC
Q 046686           24 SRDVFEAACDYARDRSG-LQWEDS   46 (70)
Q Consensus        24 s~~~fe~~~~yA~~~gv-LlW~~~   46 (70)
                      ..+.|+.+.+.|++.++ +.|+||
T Consensus        75 ~~~~~~~~~~~a~~~~i~l~~SnP   98 (183)
T PF13707_consen   75 EHEKLEEAIKKAKRNKINLAVSNP   98 (183)
T ss_pred             cHHHHHHHHHhccccCeEEEEecC
Confidence            57789999999999888 777777


No 62 
>PF01378 IgG_binding_B:  B domain;  InterPro: IPR000724 This domain is found as a tandem repeat in Streptococcal cell surface proteins, such as the IgG binding proteins G and MIG. These proteins are type I membrane proteins that bind to the constant Fc region of IgG with high affinity. The N terminus of MIG mediates binding to plasma proteinase inhibitor alpha 2-macroglobulin after complex formation with proteases.; GO: 0005618 cell wall; PDB: 1IGC_A 2IGH_A 2NMQ_A 1IGD_A 1PGX_A 2IGD_A 1QKZ_A 1GB4_A 1FCC_D 1FCL_A ....
Probab=26.06  E-value=1.1e+02  Score=17.67  Aligned_cols=25  Identities=28%  Similarity=0.426  Sum_probs=18.4

Q ss_pred             HHHHHHHHcCe-EEee-eCCcceEEEe
Q 046686           30 AACDYARDRSG-LQWE-DSKKMRLVVK   54 (70)
Q Consensus        30 ~~~~yA~~~gv-LlW~-~~~kr~~~V~   54 (70)
                      .-.+||.+.|| ..|. |+....|+|+
T Consensus        28 ~F~~yan~ngv~gew~yd~at~tftvt   54 (55)
T PF01378_consen   28 AFRQYANDNGVDGEWSYDDATKTFTVT   54 (55)
T ss_dssp             HHHHHHHHTTTTSEEEEETTTTEEEEE
T ss_pred             HHHHHhccCCCCCccccccchhheecc
Confidence            45789999999 7785 4556677765


No 63 
>TIGR03613 RutR pyrimidine utilization regulatory protein R. This protein is observed in operons extremely similar to that characterized in E. coli K-12 responsible for the import and catabolism of pyrimidines, primarily uracil. This protein is a member of the TetR family of transcriptional regulators defined by the N-teminal model pfam00440 and the C-terminal model pfam08362 (YcdC-like protein, C-terminal region).
Probab=26.01  E-value=22  Score=23.12  Aligned_cols=28  Identities=21%  Similarity=0.306  Sum_probs=21.7

Q ss_pred             ceeeeceEEecCCCCHHH-HHHHHHHHHH
Q 046686           10 KDEMTRVHYYDEFPSRDV-FEAACDYARD   37 (70)
Q Consensus        10 Ri~~~~g~Ly~~F~s~~~-fe~~~~yA~~   37 (70)
                      +...++|-+|.-|.|.++ |..++++.-+
T Consensus        37 ~agvs~~~lY~hF~sKe~L~~av~~~~~~   65 (202)
T TIGR03613        37 LAGVSKTNLLYYFPSKDALYLAVLRQILD   65 (202)
T ss_pred             HhCCCHHHHHHHcCCHHHHHHHHHHHHHH
Confidence            456788999999999777 7777776543


No 64 
>cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=25.68  E-value=1.4e+02  Score=17.08  Aligned_cols=43  Identities=5%  Similarity=-0.090  Sum_probs=30.7

Q ss_pred             eEEecCCCCHHHHHHHHHHHHHcCeEEeeeC-----CcceEEEecccc
Q 046686           16 VHYYDEFPSRDVFEAACDYARDRSGLQWEDS-----KKMRLVVKAEIH   58 (70)
Q Consensus        16 g~Ly~~F~s~~~fe~~~~yA~~~gvLlW~~~-----~kr~~~V~~~gh   58 (70)
                      ..++=..+|.++.+.+.+.+.+.|+-+=..+     .....|..++||
T Consensus        61 ~~~~~~v~~~~~~~~~~~~~~~~g~~v~~~~~~~~~g~~~~~~DPdGn  108 (114)
T cd07261          61 SELAFMVDDGAAVDALYAEWQAKGVKIIQEPTEMDFGYTFVALDPDGH  108 (114)
T ss_pred             eEEEEEcCCHHHHHHHHHHHHHCCCeEecCccccCCccEEEEECCCCC
Confidence            4555577888999999999999998554332     233555568877


No 65 
>cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC). This subfamily contains the N-terminal, non-catalytic, domain of PpCmtC. 2,3-dihydroxy-p-cumate-3,4-dioxygenase (CmtC of Pseudomonas putida F1) is a dioxygenase involved in the eight-step catabolism pathway of p-cymene. CmtC acts upon the reaction intermediate 2,3-dihydroxy-p-cumate, yielding 2-hydroxy-3-carboxy-6-oxo-7-methylocta-2,4-dienoate. The CmtC belongs to the type I family of extradiol dioxygenases. Fe2+ was suggested as a cofactor, same as other enzymes in the family. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=25.52  E-value=1.3e+02  Score=17.96  Aligned_cols=39  Identities=13%  Similarity=0.049  Sum_probs=27.1

Q ss_pred             CCCCHHHHHHHHHHHHHcCeE-EeeeCC-------cc-eEEEeccccH
Q 046686           21 EFPSRDVFEAACDYARDRSGL-QWEDSK-------KM-RLVVKAEIHI   59 (70)
Q Consensus        21 ~F~s~~~fe~~~~yA~~~gvL-lW~~~~-------kr-~~~V~~~gh~   59 (70)
                      .+.|.++.+.+.+..++.|+- .+..+.       .+ ..|..++||.
T Consensus        66 ~v~~~~dv~~~~~~l~~~G~~~~~~~~~~~~~~~~~~~~~f~DPdG~~  113 (124)
T cd08361          66 ELRDDDALESAATELEQYGHEVRRGTAEECELRKVKAFIAFRDPSGNS  113 (124)
T ss_pred             EECCHHHHHHHHHHHHHcCCceEEcCHHHhhcCCcceEEEEECcCCCE
Confidence            468889999999999999984 442211       22 3456688773


No 66 
>COG4509 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.44  E-value=78  Score=23.26  Aligned_cols=29  Identities=14%  Similarity=0.084  Sum_probs=24.9

Q ss_pred             eeceEEecCCCCHHHHHHHHHHHHHcCeE
Q 046686           13 MTRVHYYDEFPSRDVFEAACDYARDRSGL   41 (70)
Q Consensus        13 ~~~g~Ly~~F~s~~~fe~~~~yA~~~gvL   41 (70)
                      +.+-|+..+||+..||..-++.-+...|.
T Consensus       178 t~d~yi~tef~~d~dy~~fLne~KqkSV~  206 (244)
T COG4509         178 TDDYYIETEFPVDIDYNEFLNEIKQKSVQ  206 (244)
T ss_pred             ccceeeecCCCCchhHHHHHHHHHhhhee
Confidence            45678899999999999999999987764


No 67 
>PF02677 DUF208:  Uncharacterized BCR, COG1636;  InterPro: IPR003828 This entry describes proteins of unknown function.
Probab=24.85  E-value=57  Score=22.69  Aligned_cols=27  Identities=11%  Similarity=0.311  Sum_probs=23.7

Q ss_pred             ceEEecCCCCHHHHHHHHHHHHHcCeE
Q 046686           15 RVHYYDEFPSRDVFEAACDYARDRSGL   41 (70)
Q Consensus        15 ~g~Ly~~F~s~~~fe~~~~yA~~~gvL   41 (70)
                      -.++|.||-...-|..-.+.+++.|..
T Consensus       136 v~f~~~DfRk~~g~~~~~~lske~glY  162 (176)
T PF02677_consen  136 VEFLYRDFRKKNGFQRSIELSKELGLY  162 (176)
T ss_pred             CeEEeeccccCccHHHHHHHHHHhCCc
Confidence            358999999999999999999999864


No 68 
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase. This family is a subset of the Pfam model pfam03102 and is believed to include only authentic NeuB N-acetylneuraminate (sialic acid) synthase enzymes. The majority of the genes identified by this model are observed adjacent to both the NeuA and NeuC genes which together effect the biosynthesis of CMP-N-acetylneuraminate from UDP-N-acetylglucosamine.
Probab=24.73  E-value=89  Score=23.45  Aligned_cols=24  Identities=8%  Similarity=0.022  Sum_probs=19.9

Q ss_pred             CCHHHHHHHHHHHHHcCeEEeeeC
Q 046686           23 PSRDVFEAACDYARDRSGLQWEDS   46 (70)
Q Consensus        23 ~s~~~fe~~~~yA~~~gvLlW~~~   46 (70)
                      .+.++|+.+.+||++.|+...+.+
T Consensus        73 l~~e~~~~L~~~~~~~Gi~~~stp   96 (329)
T TIGR03569        73 LSEEDHRELKEYCESKGIEFLSTP   96 (329)
T ss_pred             CCHHHHHHHHHHHHHhCCcEEEEe
Confidence            457889999999999999876544


No 69 
>PF13018 ESPR:  Extended Signal Peptide of Type V secretion system
Probab=24.44  E-value=98  Score=14.85  Aligned_cols=16  Identities=25%  Similarity=0.541  Sum_probs=10.4

Q ss_pred             eEEeeeCCcceEEEec
Q 046686           40 GLQWEDSKKMRLVVKA   55 (70)
Q Consensus        40 vLlW~~~~kr~~~V~~   55 (70)
                      -++|+......++|++
T Consensus         6 r~iwn~~~~~~vvvsE   21 (24)
T PF13018_consen    6 RLIWNKARGTWVVVSE   21 (24)
T ss_pred             EEEEECCCCeEEEEee
Confidence            3789766666666654


No 70 
>PF00440 TetR_N:  Bacterial regulatory proteins, tetR family;  InterPro: IPR001647 This entry represents a DNA-binding domain with a helix-turn-helix (HTH) structure that is found in several bacterial and archaeal transcriptional regulators, such as TetR, the tetracycline resistance repressor. Numerous other transcriptional regulatory proteins also contain HTH-type DNA-binding domains, and can be grouped into subfamiles based on sequence similarity. The domain represented by this entry is found in a subfamily of proteins that includes the transcriptional regulators TetR, TetC, AcrR, BetI, Bm3R1, EnvR, QacR, MtrR, TcmR, Ttk, YbiH, and YhgD [, , ]. Many of these proteins function as repressors that control the level of susceptibility to hydrophobic antibiotics and detergents. They all have similar molecular weights, ranging from 21 to 25 kDa. The helix-turn-helix motif is located in the initial third of the protein. The 3D structure of the homodimeric TetR protein complexed with 7-chloro-tetracycline-magnesium has been determined to 2.1 A resolution []. TetR folds into ten alpha-helices with connecting turns and loops. The three N-terminal alpha-helices of the repressor form the DNA-binding domain: this structural motif encompasses an HTH fold with an inverse orientation compared with that of other DNA-binding proteins.; GO: 0003677 DNA binding; PDB: 3NPI_B 3IUV_A 3CCY_A 2JK3_A 2FX0_A 2JJ7_A 2WV1_B 3BTI_D 3BR6_E 3BR5_A ....
Probab=24.06  E-value=14  Score=19.43  Aligned_cols=20  Identities=25%  Similarity=0.572  Sum_probs=15.7

Q ss_pred             ceeeeceEEecCCCCHHHHH
Q 046686           10 KDEMTRVHYYDEFPSRDVFE   29 (70)
Q Consensus        10 Ri~~~~g~Ly~~F~s~~~fe   29 (70)
                      |...+.+.+|.-|+|.++.-
T Consensus        25 ~~gvs~~~~y~~f~~k~~l~   44 (47)
T PF00440_consen   25 RAGVSKGSFYRYFPSKDDLL   44 (47)
T ss_dssp             HHTSCHHHHHHHCSSHHHHH
T ss_pred             HHccchhhHHHHcCCHHHHH
Confidence            45567888999999988753


No 71 
>PF07845 DUF1636:  Protein of unknown function (DUF1636);  InterPro: IPR012863 The sequences featured in this family are derived from a number of hypothetical prokaryotic proteins. The region in question is approximately 130 amino acids long. 
Probab=24.03  E-value=65  Score=20.79  Aligned_cols=32  Identities=9%  Similarity=0.255  Sum_probs=24.7

Q ss_pred             ceEEecCCCCHHHHHHHHHHHH-----HcCeEEeeeC
Q 046686           15 RVHYYDEFPSRDVFEAACDYAR-----DRSGLQWEDS   46 (70)
Q Consensus        15 ~g~Ly~~F~s~~~fe~~~~yA~-----~~gvLlW~~~   46 (70)
                      -+|||-||.-.++=+.+++||+     +-|.+-|...
T Consensus        66 ~tYlfGdl~p~~~a~~il~~a~~Y~~s~dG~vp~~~r  102 (116)
T PF07845_consen   66 WTYLFGDLDPDEDAEDILAFAALYAASPDGLVPWRER  102 (116)
T ss_pred             cEEEEecCCcccCHHHHHHHHHHHHhCCCCccccccC
Confidence            4799999998788888888776     4577777654


No 72 
>cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive. This subfamily family contains FosA, a fosfomycin resistant protein. Fosfomycin inhibits the enzyme UDP-N-acetylglucosamine-3-enolpyruvyltransferase (MurA), which catalyzes the first committed step in bacterial cell wall biosynthesis. FosA, catalyzes the addition of glutathione to the antibiotic fosfomycin, (1R,2S)-epoxypropylphosphonic acid, making it inactive. FosA is a Mn(II) dependent enzyme. It is evolutionarily related to glyoxalase I and type I extradiol dioxygenases.
Probab=23.91  E-value=1.6e+02  Score=17.38  Aligned_cols=34  Identities=12%  Similarity=0.258  Sum_probs=25.6

Q ss_pred             HHHHHHHHHHHHHcCeEEeeeC---CcceEEEecccc
Q 046686           25 RDVFEAACDYARDRSGLQWEDS---KKMRLVVKAEIH   58 (70)
Q Consensus        25 ~~~fe~~~~yA~~~gvLlW~~~---~kr~~~V~~~gh   58 (70)
                      .++.+.+.+.+++.|+-++..+   .+...|..++|+
T Consensus        67 ~~dl~~~~~~l~~~G~~~~~~~~~~~~~~~f~DPdG~  103 (121)
T cd07244          67 EEDFASLKEKLRQAGVKEWKENTSEGDSFYFLDPDGH  103 (121)
T ss_pred             HHHHHHHHHHHHHcCCcccCCCCCCccEEEEECCCCC
Confidence            4789999999999999888543   244566667776


No 73 
>PF03588 Leu_Phe_trans:  Leucyl/phenylalanyl-tRNA protein transferase;  InterPro: IPR004616 Leucyl/phenylalanyl-tRNA--protein transferase 2.3.2.6 from EC transfers a Leu or Phe to the amino end of certain proteins to enable degradation. The N-terminal residue controls the biological half-life of many proteins via the N-end rule pathway.; GO: 0008914 leucyltransferase activity, 0030163 protein catabolic process; PDB: 2Z3L_A 2Z3O_A 2Z3P_A 2DPT_B 2Z3M_B 2Z3N_B 2DPS_B 2Z3K_B 2CXA_A.
Probab=23.76  E-value=87  Score=21.62  Aligned_cols=31  Identities=23%  Similarity=0.516  Sum_probs=17.2

Q ss_pred             HcCeEEeeeCCcceEEEeccccHH--HHHHHHh
Q 046686           37 DRSGLQWEDSKKMRLVVKAEIHIH--IREFLRG   67 (70)
Q Consensus        37 ~~gvLlW~~~~kr~~~V~~~gh~~--vr~f~k~   67 (70)
                      +-+-++|-++..|+++-..+-|-.  +|..+|+
T Consensus        19 ~~~pilW~sp~pR~vl~~~~~hiskslrk~lr~   51 (173)
T PF03588_consen   19 EGDPILWWSPDPRAVLPPDDFHISKSLRKFLRK   51 (173)
T ss_dssp             TTS--EEE--SSEEEE-GGG----HHHHHHHHT
T ss_pred             CCCceeeecCCCcEEEeccccccCHHHHHHhCC
Confidence            456789999999998887777755  7777775


No 74 
>PF12696 TraG-D_C:  TraM recognition site of TraD and TraG
Probab=23.33  E-value=1.1e+02  Score=18.97  Aligned_cols=27  Identities=19%  Similarity=0.018  Sum_probs=21.9

Q ss_pred             EEecCCCCH---HHHHHHHHHHHHcCeEEe
Q 046686           17 HYYDEFPSR---DVFEAACDYARDRSGLQW   43 (70)
Q Consensus        17 ~Ly~~F~s~---~~fe~~~~yA~~~gvLlW   43 (70)
                      ++.++|++.   ..++.+..-++..|+.+|
T Consensus         4 ~~lDE~~~~~~~~~l~~~~~~~r~~gi~~~   33 (128)
T PF12696_consen    4 FILDEFGNLGPIPGLEDLLATGRSYGISFI   33 (128)
T ss_pred             EEEEChhhcCCcHhHHHHHHHHhcCCCEEE
Confidence            567777764   579999999999999876


No 75 
>PF10662 PduV-EutP:  Ethanolamine utilisation - propanediol utilisation;  InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways. Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively. The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems. Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose [, ]. More than 1% of the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect [, ]. The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella [, , ]. Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 cellular biogenic amine metabolic process
Probab=22.95  E-value=2.3e+02  Score=18.89  Aligned_cols=36  Identities=17%  Similarity=0.199  Sum_probs=29.1

Q ss_pred             CHHHHHHHHHHHHHcCeEEeeeCCcceEEEe---ccccHHHHHHHH
Q 046686           24 SRDVFEAACDYARDRSGLQWEDSKKMRLVVK---AEIHIHIREFLR   66 (70)
Q Consensus        24 s~~~fe~~~~yA~~~gvLlW~~~~kr~~~V~---~~gh~~vr~f~k   66 (70)
                      +.++-+.+..+-+..|+       +..|.||   .+|-+.+++|++
T Consensus       104 ~~~~i~~a~~~L~~aG~-------~~if~vS~~~~eGi~eL~~~L~  142 (143)
T PF10662_consen  104 DDANIERAKKWLKNAGV-------KEIFEVSAVTGEGIEELKDYLE  142 (143)
T ss_pred             chhhHHHHHHHHHHcCC-------CCeEEEECCCCcCHHHHHHHHh
Confidence            67889999999999998       2346664   789999999986


No 76 
>PF07409 GP46:  Phage protein GP46;  InterPro: IPR010877 This entry is represented by Bacteriophage Mu, Gp46. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=22.88  E-value=52  Score=21.32  Aligned_cols=28  Identities=43%  Similarity=0.633  Sum_probs=17.9

Q ss_pred             cccccccCceeeeceEEecCCCCHHHHHHHHHHHHHcCeEEe
Q 046686            2 RLWESDLNKDEMTRVHYYDEFPSRDVFEAACDYARDRSGLQW   43 (70)
Q Consensus         2 rLWe~ErnRi~~~~g~Ly~~F~s~~~fe~~~~yA~~~gvLlW   43 (70)
                      |||.++|....            .+.-..+.+||+|  +|-|
T Consensus        45 RLwlL~R~K~t------------~~v~~~A~~ya~E--AL~w   72 (116)
T PF07409_consen   45 RLWLLRREKLT------------PRVRRRAEDYAEE--ALQW   72 (116)
T ss_pred             ceeEEEeecch------------HHHHHHHHHHHHH--HHHH
Confidence            68888876543            3355677888876  4444


No 77 
>cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=22.76  E-value=1.7e+02  Score=16.93  Aligned_cols=37  Identities=19%  Similarity=0.044  Sum_probs=25.3

Q ss_pred             CCCHHHHHHHHHHHHHcCeEEeeeCC----cceEEEecccc
Q 046686           22 FPSRDVFEAACDYARDRSGLQWEDSK----KMRLVVKAEIH   58 (70)
Q Consensus        22 F~s~~~fe~~~~yA~~~gvLlW~~~~----kr~~~V~~~gh   58 (70)
                      ..|.++.+.+++.+++.|+-+..-..    +...|-.++|+
T Consensus        72 v~~~~~v~~~~~~l~~~g~~~~~~~~~~~~~~~~~~DPdG~  112 (125)
T cd07255          72 LPSRADLAAALRRLIELGIPLVGASDHLVSEALYLSDPEGN  112 (125)
T ss_pred             CCCHHHHHHHHHHHHHcCCceeccccccceeEEEEECCCCC
Confidence            46788999999999999996643211    12334557765


No 78 
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain. The only examples in which the wobble position of a tRNA must discriminate between G and A of mRNA are AUA (Ile) vs. AUG (Met) and UGA (stop) vs. UGG (Trp). In all bacteria, the wobble position of the tRNA(Ile) recognizing AUA is lysidine, a lysine derivative of cytidine. This family describes a protein domain found, apparently, in all bacteria in a single copy. Eukaryotic sequences appear to be organellar. The domain archictecture of this protein family is variable; some, including characterized proteins of E. coli and B. subtilis known to be tRNA(Ile)-lysidine synthetase, include a conserved 50-residue domain that many other members lack. This protein belongs to the ATP-binding PP-loop family ( pfam01171). It appears in the literature and protein databases as TilS, YacA, and putative cell cycle protein MesJ (a misnomer).
Probab=22.61  E-value=1.1e+02  Score=19.91  Aligned_cols=19  Identities=16%  Similarity=0.258  Sum_probs=16.0

Q ss_pred             HHHHHHHHHcCeEEeeeCC
Q 046686           29 EAACDYARDRSGLQWEDSK   47 (70)
Q Consensus        29 e~~~~yA~~~gvLlW~~~~   47 (70)
                      +.+.+||++.|+-.|.++.
T Consensus       154 ~ei~~~~~~~~lp~~~~~~  172 (189)
T TIGR02432       154 SEIEEYLKENGLPWFEDET  172 (189)
T ss_pred             HHHHHHHHHcCCCeeeCCC
Confidence            3568999999999998875


No 79 
>PRK14996 TetR family transcriptional regulator; Provisional
Probab=22.51  E-value=36  Score=22.07  Aligned_cols=22  Identities=14%  Similarity=0.073  Sum_probs=16.9

Q ss_pred             ceeeeceEEecCCCCHHH-HHHH
Q 046686           10 KDEMTRVHYYDEFPSRDV-FEAA   31 (70)
Q Consensus        10 Ri~~~~g~Ly~~F~s~~~-fe~~   31 (70)
                      +.-.+.|-||.-|+|.++ |..+
T Consensus        37 ~aGvsk~~lY~~F~sK~~L~~~~   59 (192)
T PRK14996         37 EAQVAAGQVHHHFSSAGELKALA   59 (192)
T ss_pred             HhCCCcHHHHHHcCCHHHHHHHH
Confidence            345688999999999888 4443


No 80 
>PF12681 Glyoxalase_2:  Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A ....
Probab=21.97  E-value=1.6e+02  Score=16.45  Aligned_cols=33  Identities=3%  Similarity=0.035  Sum_probs=22.6

Q ss_pred             HHHHHHHHHHHHcCeEEeee----C-C-cceEEEecccc
Q 046686           26 DVFEAACDYARDRSGLQWED----S-K-KMRLVVKAEIH   58 (70)
Q Consensus        26 ~~fe~~~~yA~~~gvLlW~~----~-~-kr~~~V~~~gh   58 (70)
                      ++.+.+.+.+++.|+-+-..    + . +...|..++||
T Consensus        65 ~dv~~~~~~l~~~G~~~~~~~~~~~~g~~~~~~~DPdG~  103 (108)
T PF12681_consen   65 EDVDALYERLKELGAEIVTEPRDDPWGQRSFYFIDPDGN  103 (108)
T ss_dssp             SHHHHHHHHHHHTTSEEEEEEEEETTSEEEEEEE-TTS-
T ss_pred             cCHHHHHHHHHHCCCeEeeCCEEcCCCeEEEEEECCCCC
Confidence            88999999999999875432    2 2 34556668876


No 81 
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism]
Probab=21.77  E-value=1.3e+02  Score=22.63  Aligned_cols=30  Identities=23%  Similarity=0.272  Sum_probs=24.9

Q ss_pred             CHHHHHHHHHHHHHcCeEEeeeCCcceEEE
Q 046686           24 SRDVFEAACDYARDRSGLQWEDSKKMRLVV   53 (70)
Q Consensus        24 s~~~fe~~~~yA~~~gvLlW~~~~kr~~~V   53 (70)
                      |.++++.++++|++.|+++=+|+.=.-|+-
T Consensus       181 ~~~~l~~i~~~a~~~~i~ii~DEiY~~l~y  210 (393)
T COG0436         181 SKEELKAIVELAREHDIIIISDEIYEELVY  210 (393)
T ss_pred             CHHHHHHHHHHHHHcCeEEEEehhhhhccc
Confidence            689999999999999999888876555544


No 82 
>PF11305 DUF3107:  Protein of unknown function (DUF3107);  InterPro: IPR021456  Some members in this family of proteins are annotated as ATP-binding proteins however this cannot be confirmed. Currently no function is known. 
Probab=21.69  E-value=2e+02  Score=17.37  Aligned_cols=36  Identities=33%  Similarity=0.227  Sum_probs=27.4

Q ss_pred             CCCCHHHHHHHHHHHHHcC--eEEeeeCCcceEEEecc
Q 046686           21 EFPSRDVFEAACDYARDRS--GLQWEDSKKMRLVVKAE   56 (70)
Q Consensus        21 ~F~s~~~fe~~~~yA~~~g--vLlW~~~~kr~~~V~~~   56 (70)
                      .=.|+++-...+.-|-.-|  +|--.|++.|.++|..+
T Consensus        18 s~~s~dev~~~v~~Al~~~~~~l~LtD~kGr~~lVp~~   55 (74)
T PF11305_consen   18 SDQSADEVEAAVTDALADGSGVLTLTDEKGRRVLVPAA   55 (74)
T ss_pred             cCCCHHHHHHHHHHHHhCCCceEEEEeCCCCEEEEECC
Confidence            3357777777777776655  78889999999999764


No 83 
>PF03614 Flag1_repress:  Repressor of phase-1 flagellin;  InterPro: IPR003223 Flagellin is the subunit which polymerises to form the filaments of bacterial flagella. The proteins in this family are transcriptional repressors of phase-1 flagellin genes.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent
Probab=21.66  E-value=70  Score=22.26  Aligned_cols=20  Identities=30%  Similarity=0.409  Sum_probs=17.6

Q ss_pred             CCHHHHHHHHHHHHHcCeEE
Q 046686           23 PSRDVFEAACDYARDRSGLQ   42 (70)
Q Consensus        23 ~s~~~fe~~~~yA~~~gvLl   42 (70)
                      ||..||-++|++|-+.|+=+
T Consensus       104 psrrDFF~Icrka~qqg~sI  123 (165)
T PF03614_consen  104 PSRRDFFSICRKAHQQGKSI  123 (165)
T ss_pred             CccchHHHHHHHHHHCCCeE
Confidence            88899999999999988743


No 84 
>PF00128 Alpha-amylase:  Alpha amylase, catalytic domain;  InterPro: IPR006047 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site.  Enzymes containing this domain, such as alpha-amylase, belong to family 13 (GH13 from CAZY) of the glycosyl hydrolases. The maltogenic alpha-amylase is an enzyme which catalyses hydrolysis of (1-4)-alpha-D-glucosidic linkages in polysaccharides so as to remove successive alpha-maltose residues from the non-reducing ends of the chains in the conversion of starch to maltose. Other enzymes include neopullulanase, which hydrolyses pullulan to panose, and cyclomaltodextrinase, which hydrolyses cyclodextrins. This entry represents the catalytic domain found in several protein members of this family. It has a structure consisting of an 8 stranded alpha/beta barrel that contains the active site, interrupted by a ~70 amino acid calcium-binding domain protruding between beta strand 3 and alpha helix 3, and a carboxyl-terminal Greek key beta-barrel domain []. More information about this protein can be found at Protein of the Month: alpha-Amylase [].; GO: 0003824 catalytic activity, 0043169 cation binding, 0005975 carbohydrate metabolic process; PDB: 3FAX_A 3FAW_A 2DH3_B 2DH2_A 1CIU_A 1A47_A 3BMW_A 3BMV_A 2FH8_A 2FH6_A ....
Probab=21.38  E-value=92  Score=20.86  Aligned_cols=24  Identities=21%  Similarity=0.181  Sum_probs=20.6

Q ss_pred             cCCCCHHHHHHHHHHHHHcCeEEe
Q 046686           20 DEFPSRDVFEAACDYARDRSGLQW   43 (70)
Q Consensus        20 ~~F~s~~~fe~~~~yA~~~gvLlW   43 (70)
                      ..|-+.+||..+++-|.+.|+-|=
T Consensus        46 ~~~Gt~~d~~~Lv~~~h~~gi~Vi   69 (316)
T PF00128_consen   46 PRFGTMEDFKELVDAAHKRGIKVI   69 (316)
T ss_dssp             TTTBHHHHHHHHHHHHHHTTCEEE
T ss_pred             cccchhhhhhhhhhccccccceEE
Confidence            367889999999999999998654


No 85 
>PRK05569 flavodoxin; Provisional
Probab=21.37  E-value=1.8e+02  Score=17.95  Aligned_cols=24  Identities=13%  Similarity=0.192  Sum_probs=14.1

Q ss_pred             ceEEecCCCCHHHHHHHHHHHHHc
Q 046686           15 RVHYYDEFPSRDVFEAACDYARDR   38 (70)
Q Consensus        15 ~g~Ly~~F~s~~~fe~~~~yA~~~   38 (70)
                      .++-+..-|+.++.+.+.++++++
T Consensus       116 ~~~~~~~~p~~~~~~~~~~~g~~l  139 (141)
T PRK05569        116 GDLAVNESPNKEELNSAKELGKKL  139 (141)
T ss_pred             eeEEEccCCCHHHHHHHHHHHHHH
Confidence            344445556666666666666654


No 86 
>PRK09485 mmuM homocysteine methyltransferase; Provisional
Probab=21.34  E-value=1.9e+02  Score=21.02  Aligned_cols=31  Identities=16%  Similarity=0.281  Sum_probs=26.7

Q ss_pred             eceEEecCCCCHHHHHHHHHHHHHc--CeEEee
Q 046686           14 TRVHYYDEFPSRDVFEAACDYARDR--SGLQWE   44 (70)
Q Consensus        14 ~~g~Ly~~F~s~~~fe~~~~yA~~~--gvLlW~   44 (70)
                      -+.+++.-|+|..|-..++..+++.  +.-+|-
T Consensus       154 vD~i~~ET~~~~~E~~~~~~~~~~~~~~~pv~i  186 (304)
T PRK09485        154 ADLLACETIPNLDEAEALVELLKEEFPGVPAWL  186 (304)
T ss_pred             CCEEEEeccCCHHHHHHHHHHHHHhcCCCcEEE
Confidence            4778999999999999999999966  676664


No 87 
>cd02407 PTH2_family Peptidyl-tRNA hydrolase, type 2 (PTH2)_like . Peptidyl-tRNA hydrolase activity releases tRNA from the premature translation termination product peptidyl-tRNA. Two structurally different enzymes have been reported to encode such activity, Pth present in bacteria and eukaryotes and Pth2 present in archaea and eukaryotes.
Probab=21.34  E-value=1.5e+02  Score=18.84  Aligned_cols=24  Identities=17%  Similarity=0.148  Sum_probs=18.9

Q ss_pred             CCCHHHHHHHHHHHHHcCe--EEeee
Q 046686           22 FPSRDVFEAACDYARDRSG--LQWED   45 (70)
Q Consensus        22 F~s~~~fe~~~~yA~~~gv--LlW~~   45 (70)
                      =+|.++...+.+-|++.|+  -+|.|
T Consensus        56 v~~~~~l~~l~~~a~~~gl~~~~v~D   81 (115)
T cd02407          56 VPSEEELLELAKKAKELGLPHSLIQD   81 (115)
T ss_pred             CCCHHHHHHHHHHHHHcCCCeEEEEE
Confidence            3677889999999988775  57777


No 88 
>KOG1359 consensus Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA ligase [Amino acid transport and metabolism]
Probab=20.68  E-value=2.1e+02  Score=22.50  Aligned_cols=50  Identities=12%  Similarity=-0.061  Sum_probs=38.0

Q ss_pred             cCceeeeceEEecCCCCHHHHHHHHHHHHHcCeEEeeeCCcceEEEecccc
Q 046686            8 LNKDEMTRVHYYDEFPSRDVFEAACDYARDRSGLQWEDSKKMRLVVKAEIH   58 (70)
Q Consensus         8 rnRi~~~~g~Ly~~F~s~~~fe~~~~yA~~~gvLlW~~~~kr~~~V~~~gh   58 (70)
                      |-|+..|+|+. +-=-+-+--+.++..|+..|.||.-|+-.-+.|..+.|-
T Consensus       193 r~klv~TDg~F-SMDGdiaPl~ei~~La~kYgaLlfiDecHaTgf~G~tGr  242 (417)
T KOG1359|consen  193 RLKLVVTDGVF-SMDGDIAPLEEISQLAKKYGALLFIDECHATGFFGETGR  242 (417)
T ss_pred             eEEEEEeccee-ccCCCcccHHHHHHHHHhcCcEEEEeecccceeecCCCC
Confidence            66788888863 322233445778999999999999999999999877654


No 89 
>smart00642 Aamy Alpha-amylase domain.
Probab=20.47  E-value=1.7e+02  Score=19.38  Aligned_cols=25  Identities=24%  Similarity=0.198  Sum_probs=21.1

Q ss_pred             CCCCHHHHHHHHHHHHHcCeEEeee
Q 046686           21 EFPSRDVFEAACDYARDRSGLQWED   45 (70)
Q Consensus        21 ~F~s~~~fe~~~~yA~~~gvLlW~~   45 (70)
                      .|-+.++|..+++-|.+.|+-+--|
T Consensus        65 ~~Gt~~d~~~lv~~~h~~Gi~vilD   89 (166)
T smart00642       65 RFGTMEDFKELVDAAHARGIKVILD   89 (166)
T ss_pred             ccCCHHHHHHHHHHHHHCCCEEEEE
Confidence            5678899999999999999976543


No 90 
>PF01402 RHH_1:  Ribbon-helix-helix protein, copG family;  InterPro: IPR002145 CopG, also known as RepA, is responsible for the regulation of plasmid copy number. It binds to the repAB promoter and controls synthesis of the plasmid replication initiator protein RepB. Many bacterial transcription regulation proteins bind DNA through a 'helix-turn-helix' motif, nevertheless CopG displays a fully defined HTH-motif structure that is involved not in DNA-binding, but in the maintenance of the intrinsic dimeric functional structure and cooperativity [, ].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2BJ3_B 2BJ8_A 2BJ1_A 2BJ9_A 2BJ7_B 1EA4_L 2CPG_C 1B01_B 2BA3_A 2K9I_B ....
Probab=20.35  E-value=94  Score=15.28  Aligned_cols=17  Identities=12%  Similarity=0.315  Sum_probs=13.9

Q ss_pred             CHHHHHHHHHHHHHcCe
Q 046686           24 SRDVFEAACDYARDRSG   40 (70)
Q Consensus        24 s~~~fe~~~~yA~~~gv   40 (70)
                      +.+.++.+-++|++.|.
T Consensus         7 ~~~~~~~l~~~a~~~g~   23 (39)
T PF01402_consen    7 PDELYERLDELAKELGR   23 (39)
T ss_dssp             EHHHHHHHHHHHHHHTS
T ss_pred             CHHHHHHHHHHHHHHCc
Confidence            46788999999998883


No 91 
>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion]
Probab=20.26  E-value=2.2e+02  Score=21.68  Aligned_cols=53  Identities=15%  Similarity=0.168  Sum_probs=37.9

Q ss_pred             ceeeeceEEecCCCCHHHHHHHHHHHHHcCe--EEeeeCCcceEE-EeccccHHHHHHHH
Q 046686           10 KDEMTRVHYYDEFPSRDVFEAACDYARDRSG--LQWEDSKKMRLV-VKAEIHIHIREFLR   66 (70)
Q Consensus        10 Ri~~~~g~Ly~~F~s~~~fe~~~~yA~~~gv--LlW~~~~kr~~~-V~~~gh~~vr~f~k   66 (70)
                      |+...+|.    |.|.+.-..+++.|+..|.  ..+.+...-.|. ++.+--+++.+-++
T Consensus        33 Rv~~ppgg----~l~~e~Lr~i~diAekyG~G~i~iT~rqg~ei~~i~~e~~~~v~~~L~   88 (317)
T COG2221          33 RVRTPPGG----FLSAETLRKIADIAEKYGDGLIHITSRQGLEIPGISPEDADDVVEELR   88 (317)
T ss_pred             EEecCCCC----ccCHHHHHHHHHHHHHhCCCeEEEEecCceEeccCCHHHHHHHHHHHH
Confidence            56666654    4588889999999999998  555555544444 67777777777765


No 92 
>PF01408 GFO_IDH_MocA:  Oxidoreductase family, NAD-binding Rossmann fold;  InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot. GFO is a glucose--fructose oxidoreductase, which converts D-glucose and D-fructose into D-gluconolactone and D-glucitol in the sorbitol-gluconate pathway. MOCA is a rhizopine catabolism protein which may catalyse the NADH-dependent dehydrogenase reaction involved in rhizopine catabolism. Other proteins belonging to this family include Gal80, a negative regulator for the expression of lactose and galactose metabolic genes; and several hypothetical proteins from yeast, Escherichia coli and Bacillus subtilis.  The oxidoreductase, N-terminal domain is almost always associated with the oxidoreductase, C-terminal domain (see IPR004104 from INTERPRO).; GO: 0016491 oxidoreductase activity; PDB: 1LC0_A 1LC3_A 1GCU_A 3IP3_E 3CEA_C 3EVN_A 3NTQ_A 3NTR_B 3NT5_A 3MZ0_A ....
Probab=20.11  E-value=1.4e+02  Score=17.50  Aligned_cols=23  Identities=9%  Similarity=-0.038  Sum_probs=19.6

Q ss_pred             CCCHHHHHHHHHHHHHcCeEEee
Q 046686           22 FPSRDVFEAACDYARDRSGLQWE   44 (70)
Q Consensus        22 F~s~~~fe~~~~yA~~~gvLlW~   44 (70)
                      ..|.++.+.+.+.|++.|+.++-
T Consensus        96 ~~~~~~~~~l~~~a~~~~~~~~V  118 (120)
T PF01408_consen   96 ALTLEEAEELVEAAKEKGVKVMV  118 (120)
T ss_dssp             SSSHHHHHHHHHHHHHHTSCEEE
T ss_pred             cCCHHHHHHHHHHHHHhCCEEEE
Confidence            45889999999999999988753


Done!