BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046689
         (203 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q7K734|FEN1_PLAF7 Flap endonuclease 1 OS=Plasmodium falciparum (isolate 3D7) GN=FEN1
           PE=3 SV=1
          Length = 672

 Score = 32.7 bits (73), Expect = 1.5,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 128 VDDNVDDDDDEANDVYDHNGRYDQRDHEHEIKEAVRRNDDDDDNANDEDQDVMGYYDVAF 187
           VDD  + DD++  D  D   + D+++ + E  +   +N DD+ N +DE + +  +    F
Sbjct: 444 VDDEKNLDDEKNLD--DEKNKDDEKNKDDEKNKDDEKNKDDEKNKDDEKKSLDNFSSNLF 501

Query: 188 DQVNEEDEG 196
           D   E + G
Sbjct: 502 DSDKESESG 510


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.317    0.135    0.428 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 87,075,944
Number of Sequences: 539616
Number of extensions: 3900686
Number of successful extensions: 32390
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 267
Number of HSP's successfully gapped in prelim test: 395
Number of HSP's that attempted gapping in prelim test: 23680
Number of HSP's gapped (non-prelim): 6200
length of query: 203
length of database: 191,569,459
effective HSP length: 112
effective length of query: 91
effective length of database: 131,132,467
effective search space: 11933054497
effective search space used: 11933054497
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 58 (26.9 bits)