BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046691
         (222 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4AE4|A Chain A, The Ubap1 Subunit Of Escrt-I Interacts With Ubiquitin Via
           A Novel Souba Domain
 pdb|4AE4|B Chain B, The Ubap1 Subunit Of Escrt-I Interacts With Ubiquitin Via
           A Novel Souba Domain
          Length = 118

 Score = 33.9 bits (76), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%)

Query: 165 VHIAVANYGDNPTKVREFANGYTILREMGFSSNNVAEVLIMYENDTDKALAHL 217
           V  A+  +  +  K  EF    +  +E GF   ++ EVL+++ ND D AL  L
Sbjct: 59  VEEALEXHQCSEEKXXEFLQLXSKFKEXGFELKDIKEVLLLHNNDQDNALEDL 111


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.135    0.400 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,478,469
Number of Sequences: 62578
Number of extensions: 181590
Number of successful extensions: 325
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 321
Number of HSP's gapped (non-prelim): 7
length of query: 222
length of database: 14,973,337
effective HSP length: 95
effective length of query: 127
effective length of database: 9,028,427
effective search space: 1146610229
effective search space used: 1146610229
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 49 (23.5 bits)