Query 046709
Match_columns 109
No_of_seqs 8 out of 10
Neff 1.8
Searched_HMMs 46136
Date Fri Mar 29 03:40:54 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/046709.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/046709hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF06174 DUF987: Protein of un 41.5 13 0.00027 25.7 0.8 31 58-88 4-35 (66)
2 COG3670 Lignostilbene-alpha,be 38.8 16 0.00035 32.6 1.2 39 52-107 442-480 (490)
3 COG1144 Pyruvate:ferredoxin ox 34.8 15 0.00033 26.3 0.3 10 74-83 64-74 (91)
4 cd01078 NAD_bind_H4MPT_DH NADP 34.4 68 0.0015 22.6 3.6 41 9-50 3-44 (194)
5 PF05283 MGC-24: Multi-glycosy 32.3 5.3 0.00012 31.0 -2.5 23 29-51 159-181 (186)
6 PF04752 ChaC: ChaC-like prote 29.4 24 0.00052 26.6 0.7 19 77-96 54-72 (178)
7 PF10643 Cytochrome-c551: Phot 28.7 19 0.00041 29.7 0.0 18 30-47 47-64 (233)
8 PF12360 Pax7: Paired box prot 24.4 27 0.00058 22.5 0.1 13 23-35 7-20 (45)
9 PF08817 YukD: WXG100 protein 22.5 32 0.00069 21.8 0.2 15 93-107 12-26 (79)
10 COG4302 EutC Ethanolamine ammo 21.5 73 0.0016 27.1 2.2 30 4-33 171-200 (294)
No 1
>PF06174 DUF987: Protein of unknown function (DUF987); InterPro: IPR009329 This is a family of bacterial proteins that are related to the hypothetical protein YeeT.
Probab=41.52 E-value=13 Score=25.65 Aligned_cols=31 Identities=29% Similarity=0.612 Sum_probs=23.3
Q ss_pred ccchhhhhhhcccccc-cccccccceeeeecc
Q 046709 58 VSQKAVYAISRDHHVH-NHEMCKGGICWHGVA 88 (109)
Q Consensus 58 vSrka~~a~~rdhh~h-~h~~CkGGICWHGVA 88 (109)
+|++.+-.+.|.|+.+ .-.+|.|--+|||-+
T Consensus 4 IsKr~Am~i~rqhp~sRl~ryctGkY~W~Gs~ 35 (66)
T PF06174_consen 4 ISKRRAMTIYRQHPESRLFRYCTGKYQWHGSV 35 (66)
T ss_pred eeHHHHHHHHHhCchhhccccccccceeeccc
Confidence 5777777788876643 344999999999964
No 2
>COG3670 Lignostilbene-alpha,beta-dioxygenase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=38.75 E-value=16 Score=32.60 Aligned_cols=39 Identities=36% Similarity=0.487 Sum_probs=28.7
Q ss_pred hhhceeccchhhhhhhcccccccccccccceeeeeccccCCcceeeeecCCCCCCC
Q 046709 52 GTLTWDVSQKAVYAISRDHHVHNHEMCKGGICWHGVAVRSPASQVRFRLPQQVPYG 107 (109)
Q Consensus 52 ~TLtWDvSrka~~a~~rdhh~h~h~~CkGGICWHGVAvrSpASQvrfrLPq~~P~~ 107 (109)
-|+.||..+.+++.+--|-.+-+ ++=|| |.+|||++||+
T Consensus 442 l~~vyd~~~~~Sel~v~DA~~~~----~epIa-------------~l~Lp~~vP~g 480 (490)
T COG3670 442 LTLVYDGDRHASELLVFDAQRVT----AEPIA-------------RLALPQRVPYG 480 (490)
T ss_pred EEEEEecCCCcceEEEEecccCC----CCcce-------------EEecccccccc
Confidence 47889999999999888744322 22233 68999999986
No 3
>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion]
Probab=34.80 E-value=15 Score=26.28 Aligned_cols=10 Identities=60% Similarity=1.527 Sum_probs=7.8
Q ss_pred ccccccc-cee
Q 046709 74 NHEMCKG-GIC 83 (109)
Q Consensus 74 ~h~~CkG-GIC 83 (109)
.-|+||| |||
T Consensus 64 dYdyCKGCGIC 74 (91)
T COG1144 64 DYDYCKGCGIC 74 (91)
T ss_pred EcccccCceec
Confidence 3569999 888
No 4
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase. Methylene Tetrahydromethanopterin Dehydrogenase (H4MPT DH) NADP binding domain. NADP-dependent H4MPT DH catalyzes the dehydrogenation of methylene- H4MPT and methylene-tetrahydrofolate (H4F) with NADP+ as cofactor. H4F and H4MPT are both cofactors that carry the one-carbon units between the formyl and methyl oxidation level. H4F and H4MPT are structurally analogous to each other with respect to the pterin moiety, but each has distinct side chain. H4MPT is present only in anaerobic methanogenic archaea and aerobic methylotrophic proteobacteria. H4MPT seems to have evolved independently from H4F and functions as a distinct carrier in C1 metabolism. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclo
Probab=34.44 E-value=68 Score=22.61 Aligned_cols=41 Identities=34% Similarity=0.369 Sum_probs=31.6
Q ss_pred hchhhHhHHHHHHhhhhhceecceecceEEEEee-hhHHHhhh
Q 046709 9 GNLTTIYVAVIAGIKAYGLVTGRSFSSAIVLILS-TTIVGVVL 50 (109)
Q Consensus 9 ~NlttIyvavia~ikAYg~~~GRsFSg~fVlivS-t~~V~liL 50 (109)
||.+|.|.++-+.-|+.+-. |..+++.=++++. |--++..+
T Consensus 3 G~~~ta~aav~~~~~~l~~~-~~~l~~~~vlVlGgtG~iG~~~ 44 (194)
T cd01078 3 GSNTTAAAAVAAAGKALELM-GKDLKGKTAVVLGGTGPVGQRA 44 (194)
T ss_pred CcHHHHHHHHHHHHHHHHHh-CcCCCCCEEEEECCCCHHHHHH
Confidence 79999999998888888766 7788888788885 45555433
No 5
>PF05283 MGC-24: Multi-glycosylated core protein 24 (MGC-24); InterPro: IPR007947 CD164 is a mucin-like receptor, or sialomucin, with specificity in receptor/ ligand interactions that depends on the structural characteristics of the mucin-like receptor. Its functions include mediating, or regulating, haematopoietic progenitor cell adhesion and the negative regulation of their growth and/or-differentiation. It exists in the native state as a disulphide- linked homodimer of two 80-85kDa subunits. It is usually expressed by CD34+ and CD341o/- haematopoietic stem cells and associated microenvironmental cells. It contains, in its extracellular region, two mucin domains (I and II) linked by a non-mucin domain, which has been predicted to contain intra- disulphide bridges. This receptor may play a key role in haematopoiesis by facilitating the adhesion of human CD34+ cells to bone marrow stroma and by negatively regulating CD34+ CD341o/- haematopoietic progenitor cell proliferation. These effects involve the CD164 class I and/or II epitopes recognised by the monoclonal antibodies (mAbs) 105A5 and 103B2/9E10. These epitopes are carbohydrate-dependent and are located on the N-terminal mucin domain I [, ]. It has been found that murine MGC-24v and rat endolyn share significant sequence similarities with human CD164. However, CD164 lacks the consensus glycosaminoglycan (GAG)-attachment site found in MGC-24; it is possible that GAG-association is responsible for the high molecular weight of the epithelial-derived MGC-24 glycoprotein []. Genomic structure studies have placed CD164 within the mucin-subgroup that comprises multiple exons, and demonstrate the diverse chromosomal distribution of this family of molecules. Molecules with such multiple exons may have sophisticated regulatory mechanisms that involve not only post-translational modifications of the oligosaccharide side chains, but also differential exon usage. Although differences in the intron and exon sizes are seen between the mouse and human genes, the predicted proteins are similar in size and structure, maintaining functionally important motifs that regulate cell proliferation or subcellular distribution []. CD164 is a gene whose expression depends on differential usage of poly- adenylation sites within the 3'-UTR. The conserved distribution of the 3.2- and 1.2-kb CD164 transcripts between mouse and human suggests that (i) a mechanism may exist to regulate tissue-specific polyadenylation, and (ii) differences in polyadenylation are important for the expression and function of CD164 in different tissues. Two other aspects of the structure of CD164 are of particular interest. First, it shares one of several conserved features of a cytokine-binding pocket - in this respect, it is notable that evidence exists for a class of cell-surface sialomucin modulators that directly interact with growth factor receptors to regulate their response to physiological ligands. Second, its cytoplasmic tail contains a C-terminal YHTL motif found in many endocytic membrane proteins or receptors. These Tyr-based motifs bind to adaptor proteins, which mediate the sorting of membrane proteins into transport vesicles from the plasma membrane to the endosomes, and between intracellular compartments.
Probab=32.26 E-value=5.3 Score=31.04 Aligned_cols=23 Identities=30% Similarity=0.340 Sum_probs=19.0
Q ss_pred ecceecceEEEEeehhHHHhhhh
Q 046709 29 TGRSFSSAIVLILSTTIVGVVLI 51 (109)
Q Consensus 29 ~GRsFSg~fVlivSt~~V~liLi 51 (109)
-|-||-||+||+++-.+|+++|.
T Consensus 159 D~~SFiGGIVL~LGv~aI~ff~~ 181 (186)
T PF05283_consen 159 DAASFIGGIVLTLGVLAIIFFLY 181 (186)
T ss_pred chhhhhhHHHHHHHHHHHHHHHh
Confidence 45689999999998888888764
No 6
>PF04752 ChaC: ChaC-like protein; InterPro: IPR006840 The ChaC protein is thought to be associated with the putative ChaA Ca2+/H+ cation transport protein in Escherichia coli. Its function is not known. This family also includes homologues regions from several other bacterial and eukaryotic proteins.
Probab=29.36 E-value=24 Score=26.56 Aligned_cols=19 Identities=42% Similarity=0.882 Sum_probs=14.8
Q ss_pred ccccceeeeeccccCCccee
Q 046709 77 MCKGGICWHGVAVRSPASQV 96 (109)
Q Consensus 77 ~CkGGICWHGVAvrSpASQv 96 (109)
-.++|+|| |+|-|=|+.++
T Consensus 54 ~~~~~~c~-Gvayrv~~~~~ 72 (178)
T PF04752_consen 54 PGEEGSCW-GVAYRVPEEDA 72 (178)
T ss_pred eCCCCEEE-EEEEEecCcCH
Confidence 46679998 99988887653
No 7
>PF10643 Cytochrome-c551: Photosystem P840 reaction-centre cytochrome c-551; InterPro: IPR019604 A photosynthetic reaction-centre complex is found in certain green sulphur bacteria such as Chlorobium vibrioforme, which are anaerobic photo-auto-trophic organisms. The primary electron donor is P840, a probable B-Chl a dimer, and the primary electron acceptor is a B-Chl monomer. Also on the donor side c-type cytochromes are known to function as electron donors to photo-oxidised P840. This family is thus the secondary endogenous donor of the photosynthetic reaction-centre complex and is a membrane-bound cytochrome containing a single haem group. ; PDB: 3A9F_A.
Probab=28.66 E-value=19 Score=29.65 Aligned_cols=18 Identities=22% Similarity=0.359 Sum_probs=0.0
Q ss_pred cceecceEEEEeehhHHH
Q 046709 30 GRSFSSAIVLILSTTIVG 47 (109)
Q Consensus 30 GRsFSg~fVlivSt~~V~ 47 (109)
-|||.|||.||.-..++.
T Consensus 47 l~sf~gwf~li~~aslii 64 (233)
T PF10643_consen 47 LKSFMGWFLLIFCASLII 64 (233)
T ss_dssp ------------------
T ss_pred HHHHHHHHHHHHHHHHHH
Confidence 489999999987655443
No 8
>PF12360 Pax7: Paired box protein 7 ; InterPro: IPR022106 This domain family is found in eukaryotes, and is approximately 40 amino acids in length. The family is found in association with PF00046 from PFAM, PF00292 from PFAM. Pax7 belongs to a family of genes that encode paired-box-containing transcription factors involved in the control of developmental processes. Pax7 has a distinct role in the specification of myogenic satellite cells.
Probab=24.38 E-value=27 Score=22.51 Aligned_cols=13 Identities=54% Similarity=0.762 Sum_probs=9.7
Q ss_pred hhhhceecc-eecc
Q 046709 23 KAYGLVTGR-SFSS 35 (109)
Q Consensus 23 kAYg~~~GR-sFSg 35 (109)
-||||.++| +|||
T Consensus 7 saY~Lss~Rh~Fs~ 20 (45)
T PF12360_consen 7 SAYCLSSNRHSFSG 20 (45)
T ss_pred cccccccccccccc
Confidence 489999988 4654
No 9
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold []. Ubiquitin covalently binds to protein and flags them for protein degradation, however conjugation assays have indicated that YukD lacks the capacity for covalent bond formation with other proteins []. ; PDB: 2BPS_B.
Probab=22.48 E-value=32 Score=21.82 Aligned_cols=15 Identities=40% Similarity=0.671 Sum_probs=11.9
Q ss_pred cceeeeecCCCCCCC
Q 046709 93 ASQVRFRLPQQVPYG 107 (109)
Q Consensus 93 ASQvrfrLPq~~P~~ 107 (109)
..|+-+.||.+.|.+
T Consensus 12 ~~~~Dl~lP~~vpv~ 26 (79)
T PF08817_consen 12 GRQVDLALPADVPVA 26 (79)
T ss_dssp --EEEEEEETTSBTT
T ss_pred CcEEEEEcCCCCcHH
Confidence 489999999999965
No 10
>COG4302 EutC Ethanolamine ammonia-lyase, small subunit [Amino acid transport and metabolism]
Probab=21.54 E-value=73 Score=27.08 Aligned_cols=30 Identities=33% Similarity=0.548 Sum_probs=25.7
Q ss_pred hhhhhhchhhHhHHHHHHhhhhhceeccee
Q 046709 4 SDAVIGNLTTIYVAVIAGIKAYGLVTGRSF 33 (109)
Q Consensus 4 sDaV~~NlttIyvavia~ikAYg~~~GRsF 33 (109)
++|+-.|+--|+-.+..+.|+||+--|--|
T Consensus 171 a~AI~an~~~il~~l~eglk~~G~svgt~~ 200 (294)
T COG4302 171 ALAITANYEPILPPLMEGLKAAGLSVGTPF 200 (294)
T ss_pred HHHHHhhHHHHHHHHHHHHHhcCcccCChh
Confidence 578999999999999999999998655443
Done!