BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046721
         (1068 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1G7R|A Chain A, X-Ray Structure Of Translation Initiation Factor If2EIF5B
          Length = 594

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 25/36 (69%)

Query: 140 FADLALLLIDASHGFEMETFEFLNLMQNHGLPNVMG 175
            ADLA+L++D + GF+ +T E LN+++ +  P V+ 
Sbjct: 93  LADLAILIVDINEGFKPQTQEALNILRXYRTPFVVA 128


>pdb|1G7S|A Chain A, X-Ray Structure Of Translation Initiation Factor If2EIF5B
           Complexed With Gdp
 pdb|1G7T|A Chain A, X-Ray Structure Of Translation Initiation Factor If2EIF5B
           Complexed With Gdpnp
          Length = 594

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 25/36 (69%)

Query: 140 FADLALLLIDASHGFEMETFEFLNLMQNHGLPNVMG 175
            ADLA+L++D + GF+ +T E LN+++ +  P V+ 
Sbjct: 93  LADLAILIVDINEGFKPQTQEALNILRMYRTPFVVA 128


>pdb|4AC9|A Chain A, Crystal Structure Of Translation Elongation Factor Selb
           From Methanococcus Maripaludis In Complex With Gdp
 pdb|4AC9|B Chain B, Crystal Structure Of Translation Elongation Factor Selb
           From Methanococcus Maripaludis In Complex With Gdp
 pdb|4AC9|C Chain C, Crystal Structure Of Translation Elongation Factor Selb
           From Methanococcus Maripaludis In Complex With Gdp
 pdb|4AC9|D Chain D, Crystal Structure Of Translation Elongation Factor Selb
           From Methanococcus Maripaludis In Complex With Gdp
 pdb|4ACA|A Chain A, Crystal Structure Of Translation Elongation Factor Selb
           From Methanococcus Maripaludis, Apo Form
 pdb|4ACA|B Chain B, Crystal Structure Of Translation Elongation Factor Selb
           From Methanococcus Maripaludis, Apo Form
 pdb|4ACA|C Chain C, Crystal Structure Of Translation Elongation Factor Selb
           From Methanococcus Maripaludis, Apo Form
 pdb|4ACA|D Chain D, Crystal Structure Of Translation Elongation Factor Selb
           From Methanococcus Maripaludis, Apo Form
 pdb|4ACB|A Chain A, Crystal Structure Of Translation Elongation Factor Selb
           From Methanococcus Maripaludis In Complex With The Gtp
           Analogue Gppnhp
 pdb|4ACB|B Chain B, Crystal Structure Of Translation Elongation Factor Selb
           From Methanococcus Maripaludis In Complex With The Gtp
           Analogue Gppnhp
 pdb|4ACB|C Chain C, Crystal Structure Of Translation Elongation Factor Selb
           From Methanococcus Maripaludis In Complex With The Gtp
           Analogue Gppnhp
 pdb|4ACB|D Chain D, Crystal Structure Of Translation Elongation Factor Selb
           From Methanococcus Maripaludis In Complex With The Gtp
           Analogue Gppnhp
          Length = 482

 Score = 33.1 bits (74), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 121 RLQFVECPND---INGMIDCAKFADLALLLIDASHGFEMETFEFLNLMQNHGLPNVM 174
           R+  V+ P     I  ++  A   DLAL+++DA  G + +T E + ++ +  +P ++
Sbjct: 74  RITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIV 130


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.135    0.394 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 29,291,857
Number of Sequences: 62578
Number of extensions: 1215551
Number of successful extensions: 2735
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 2729
Number of HSP's gapped (non-prelim): 8
length of query: 1068
length of database: 14,973,337
effective HSP length: 109
effective length of query: 959
effective length of database: 8,152,335
effective search space: 7818089265
effective search space used: 7818089265
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 57 (26.6 bits)