BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 046721
(1068 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1G7R|A Chain A, X-Ray Structure Of Translation Initiation Factor If2EIF5B
Length = 594
Score = 34.7 bits (78), Expect = 0.28, Method: Compositional matrix adjust.
Identities = 14/36 (38%), Positives = 25/36 (69%)
Query: 140 FADLALLLIDASHGFEMETFEFLNLMQNHGLPNVMG 175
ADLA+L++D + GF+ +T E LN+++ + P V+
Sbjct: 93 LADLAILIVDINEGFKPQTQEALNILRXYRTPFVVA 128
>pdb|1G7S|A Chain A, X-Ray Structure Of Translation Initiation Factor If2EIF5B
Complexed With Gdp
pdb|1G7T|A Chain A, X-Ray Structure Of Translation Initiation Factor If2EIF5B
Complexed With Gdpnp
Length = 594
Score = 33.5 bits (75), Expect = 0.57, Method: Compositional matrix adjust.
Identities = 14/36 (38%), Positives = 25/36 (69%)
Query: 140 FADLALLLIDASHGFEMETFEFLNLMQNHGLPNVMG 175
ADLA+L++D + GF+ +T E LN+++ + P V+
Sbjct: 93 LADLAILIVDINEGFKPQTQEALNILRMYRTPFVVA 128
>pdb|4AC9|A Chain A, Crystal Structure Of Translation Elongation Factor Selb
From Methanococcus Maripaludis In Complex With Gdp
pdb|4AC9|B Chain B, Crystal Structure Of Translation Elongation Factor Selb
From Methanococcus Maripaludis In Complex With Gdp
pdb|4AC9|C Chain C, Crystal Structure Of Translation Elongation Factor Selb
From Methanococcus Maripaludis In Complex With Gdp
pdb|4AC9|D Chain D, Crystal Structure Of Translation Elongation Factor Selb
From Methanococcus Maripaludis In Complex With Gdp
pdb|4ACA|A Chain A, Crystal Structure Of Translation Elongation Factor Selb
From Methanococcus Maripaludis, Apo Form
pdb|4ACA|B Chain B, Crystal Structure Of Translation Elongation Factor Selb
From Methanococcus Maripaludis, Apo Form
pdb|4ACA|C Chain C, Crystal Structure Of Translation Elongation Factor Selb
From Methanococcus Maripaludis, Apo Form
pdb|4ACA|D Chain D, Crystal Structure Of Translation Elongation Factor Selb
From Methanococcus Maripaludis, Apo Form
pdb|4ACB|A Chain A, Crystal Structure Of Translation Elongation Factor Selb
From Methanococcus Maripaludis In Complex With The Gtp
Analogue Gppnhp
pdb|4ACB|B Chain B, Crystal Structure Of Translation Elongation Factor Selb
From Methanococcus Maripaludis In Complex With The Gtp
Analogue Gppnhp
pdb|4ACB|C Chain C, Crystal Structure Of Translation Elongation Factor Selb
From Methanococcus Maripaludis In Complex With The Gtp
Analogue Gppnhp
pdb|4ACB|D Chain D, Crystal Structure Of Translation Elongation Factor Selb
From Methanococcus Maripaludis In Complex With The Gtp
Analogue Gppnhp
Length = 482
Score = 33.1 bits (74), Expect = 0.87, Method: Compositional matrix adjust.
Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 3/57 (5%)
Query: 121 RLQFVECPND---INGMIDCAKFADLALLLIDASHGFEMETFEFLNLMQNHGLPNVM 174
R+ V+ P I ++ A DLAL+++DA G + +T E + ++ + +P ++
Sbjct: 74 RITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIV 130
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.135 0.394
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 29,291,857
Number of Sequences: 62578
Number of extensions: 1215551
Number of successful extensions: 2735
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 2729
Number of HSP's gapped (non-prelim): 8
length of query: 1068
length of database: 14,973,337
effective HSP length: 109
effective length of query: 959
effective length of database: 8,152,335
effective search space: 7818089265
effective search space used: 7818089265
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 57 (26.6 bits)