BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046732
         (516 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2G3M|A Chain A, Crystal Structure Of The Sulfolobus Solfataricus Alpha-
           Glucosidase Mala
 pdb|2G3M|B Chain B, Crystal Structure Of The Sulfolobus Solfataricus Alpha-
           Glucosidase Mala
 pdb|2G3M|C Chain C, Crystal Structure Of The Sulfolobus Solfataricus Alpha-
           Glucosidase Mala
 pdb|2G3M|D Chain D, Crystal Structure Of The Sulfolobus Solfataricus Alpha-
           Glucosidase Mala
 pdb|2G3M|E Chain E, Crystal Structure Of The Sulfolobus Solfataricus Alpha-
           Glucosidase Mala
 pdb|2G3M|F Chain F, Crystal Structure Of The Sulfolobus Solfataricus Alpha-
           Glucosidase Mala
 pdb|2G3N|A Chain A, Crystal Structure Of The Sulfolobus Solfataricus Alpha-
           Glucosidase Mala In Complex With
           Beta-Octyl-Glucopyranoside
 pdb|2G3N|B Chain B, Crystal Structure Of The Sulfolobus Solfataricus Alpha-
           Glucosidase Mala In Complex With
           Beta-Octyl-Glucopyranoside
 pdb|2G3N|C Chain C, Crystal Structure Of The Sulfolobus Solfataricus Alpha-
           Glucosidase Mala In Complex With
           Beta-Octyl-Glucopyranoside
 pdb|2G3N|D Chain D, Crystal Structure Of The Sulfolobus Solfataricus Alpha-
           Glucosidase Mala In Complex With
           Beta-Octyl-Glucopyranoside
 pdb|2G3N|E Chain E, Crystal Structure Of The Sulfolobus Solfataricus Alpha-
           Glucosidase Mala In Complex With
           Beta-Octyl-Glucopyranoside
 pdb|2G3N|F Chain F, Crystal Structure Of The Sulfolobus Solfataricus Alpha-
           Glucosidase Mala In Complex With
           Beta-Octyl-Glucopyranoside
          Length = 693

 Score = 28.9 bits (63), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 28/61 (45%), Gaps = 9/61 (14%)

Query: 253 ISTCHKLVLEVCTAIRSVLMPKYLQWPDDDALRKIKDEFEVISGIPNVVGSMYTTHVPII 312
           +   + L LE       V+ P + ++ DDD + +I+DE+ V           Y  + PI+
Sbjct: 512 LPYIYSLALEASEKGHPVIRPLFYEFQDDDDMYRIEDEYMV---------GKYLLYAPIV 562

Query: 313 A 313
           +
Sbjct: 563 S 563


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.134    0.410 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,105,010
Number of Sequences: 62578
Number of extensions: 566111
Number of successful extensions: 1243
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 1241
Number of HSP's gapped (non-prelim): 6
length of query: 516
length of database: 14,973,337
effective HSP length: 103
effective length of query: 413
effective length of database: 8,527,803
effective search space: 3521982639
effective search space used: 3521982639
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)