Query         046733
Match_columns 106
No_of_seqs    174 out of 1110
Neff          5.4 
Searched_HMMs 46136
Date          Fri Mar 29 03:58:11 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/046733.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/046733hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00931 NB-ARC:  NB-ARC domain  98.7 1.7E-08 3.6E-13   76.3   4.2   39   67-105     1-41  (287)
  2 PLN03210 Resistant to P. syrin  98.7 1.4E-08 2.9E-13   91.8   4.0   44   62-105   184-229 (1153)
  3 KOG4658 Apoptotic ATPase [Sign  98.7 1.7E-08 3.6E-13   90.1   3.9   54   48-105   147-201 (889)
  4 PF13191 AAA_16:  AAA ATPase do  97.9 7.6E-06 1.6E-10   57.6   2.3   42   64-105     2-46  (185)
  5 cd00009 AAA The AAA+ (ATPases   97.7 4.8E-05   1E-09   49.8   3.7   40   66-105     2-41  (151)
  6 PF01637 Arch_ATPase:  Archaeal  97.7 3.1E-05 6.7E-10   55.6   2.7   41   64-104     1-41  (234)
  7 TIGR02928 orc1/cdc6 family rep  97.5 0.00011 2.4E-09   57.7   4.5   44   62-105    15-62  (365)
  8 CHL00095 clpC Clp protease ATP  97.4 0.00019   4E-09   63.6   4.0   42   62-103   179-220 (821)
  9 TIGR00635 ruvB Holliday juncti  97.3 0.00018   4E-09   55.4   3.4   43   62-104     4-51  (305)
 10 TIGR03345 VI_ClpV1 type VI sec  97.2 0.00035 7.5E-09   62.5   4.2   42   62-103   187-228 (852)
 11 PRK00411 cdc6 cell division co  97.2 0.00046   1E-08   54.9   4.2   44   62-105    30-77  (394)
 12 TIGR02639 ClpA ATP-dependent C  97.2 0.00041 8.8E-09   60.7   4.2   43   62-104   182-224 (731)
 13 PRK10865 protein disaggregatio  97.1 0.00047   1E-08   61.6   4.2   42   62-103   178-219 (857)
 14 PRK00080 ruvB Holliday junctio  97.0 0.00062 1.3E-08   53.7   3.5   43   62-104    25-72  (328)
 15 PRK13342 recombination factor   97.0 0.00049 1.1E-08   56.2   2.5   42   63-104    13-57  (413)
 16 TIGR03346 chaperone_ClpB ATP-d  96.9  0.0011 2.4E-08   59.1   4.3   42   62-103   173-214 (852)
 17 PHA02544 44 clamp loader, smal  96.9  0.0014 2.9E-08   50.8   4.0   44   62-105    21-65  (316)
 18 smart00763 AAA_PrkA PrkA AAA d  96.8  0.0013 2.8E-08   54.2   3.8   49   52-103    44-98  (361)
 19 TIGR02903 spore_lon_C ATP-depe  96.8  0.0013 2.7E-08   56.9   3.8   44   62-105   154-197 (615)
 20 PRK11034 clpA ATP-dependent Cl  96.7  0.0018   4E-08   57.4   4.3   43   62-104   186-228 (758)
 21 PRK06696 uridine kinase; Valid  96.7  0.0019 4.1E-08   48.3   3.7   38   67-104     3-43  (223)
 22 PRK00440 rfc replication facto  96.7  0.0023   5E-08   49.0   3.9   43   62-104    17-59  (319)
 23 PF05496 RuvB_N:  Holliday junc  96.6  0.0016 3.5E-08   50.8   2.8   42   62-103    24-70  (233)
 24 PRK12402 replication factor C   96.6  0.0025 5.5E-08   49.2   3.8   43   62-104    15-57  (337)
 25 PTZ00202 tuzin; Provisional     96.6   0.004 8.7E-08   53.5   5.1   43   62-104   262-307 (550)
 26 PRK07667 uridine kinase; Provi  96.5  0.0038 8.2E-08   45.9   3.9   35   70-104     2-38  (193)
 27 PRK11331 5-methylcytosine-spec  96.5  0.0029 6.3E-08   53.6   3.6   41   62-104   175-215 (459)
 28 PRK14961 DNA polymerase III su  96.4  0.0034 7.4E-08   50.5   3.7   42   62-103    16-58  (363)
 29 PLN03025 replication factor C   96.4  0.0042 9.1E-08   48.9   3.8   43   62-104    13-55  (319)
 30 PRK04195 replication factor C   96.3  0.0035 7.6E-08   52.3   2.9   43   62-104    14-60  (482)
 31 TIGR03420 DnaA_homol_Hda DnaA   96.2  0.0058 1.2E-07   44.7   3.8   37   69-105    24-60  (226)
 32 PRK13341 recombination factor   96.2   0.004 8.7E-08   55.1   3.4   43   63-105    29-74  (725)
 33 cd01128 rho_factor Transcripti  96.2  0.0025 5.5E-08   49.5   1.8   20   86-105    19-38  (249)
 34 COG2256 MGS1 ATPase related to  96.2   0.004 8.7E-08   52.4   3.1   39   62-103    30-68  (436)
 35 TIGR01242 26Sp45 26S proteasom  96.2  0.0049 1.1E-07   49.4   3.4   44   62-105   122-178 (364)
 36 TIGR02030 BchI-ChlI magnesium   96.2  0.0057 1.2E-07   49.5   3.7   42   62-103     4-45  (337)
 37 PRK03992 proteasome-activating  96.2  0.0054 1.2E-07   50.0   3.6   44   62-105   131-187 (389)
 38 COG0542 clpA ATP-binding subun  96.1   0.006 1.3E-07   54.7   3.8   41   62-102   170-210 (786)
 39 PRK14962 DNA polymerase III su  96.1   0.006 1.3E-07   51.4   3.6   42   62-103    14-56  (472)
 40 TIGR03015 pepcterm_ATPase puta  96.1  0.0036 7.8E-08   47.0   2.0   20   86-105    46-65  (269)
 41 CHL00081 chlI Mg-protoporyphyr  96.1   0.004 8.7E-08   50.9   2.4   44   62-105    17-60  (350)
 42 TIGR02397 dnaX_nterm DNA polym  96.0  0.0084 1.8E-07   46.8   3.7   42   62-103    14-56  (355)
 43 TIGR02881 spore_V_K stage V sp  96.0  0.0061 1.3E-07   46.6   2.8   43   62-104     6-63  (261)
 44 COG0466 Lon ATP-dependent Lon   95.9  0.0056 1.2E-07   54.6   2.5   42   62-103   323-370 (782)
 45 PRK14957 DNA polymerase III su  95.8  0.0085 1.9E-07   51.6   3.5   43   62-104    16-59  (546)
 46 PRK05564 DNA polymerase III su  95.8   0.012 2.6E-07   46.2   4.0   43   62-104     4-47  (313)
 47 PRK09270 nucleoside triphospha  95.8   0.011 2.5E-07   44.3   3.7   18   87-104    37-54  (229)
 48 PRK14958 DNA polymerase III su  95.8    0.01 2.2E-07   50.5   3.6   42   62-103    16-58  (509)
 49 PRK13531 regulatory ATPase Rav  95.8  0.0088 1.9E-07   51.2   3.2   41   62-104    20-60  (498)
 50 PHA00729 NTP-binding motif con  95.8  0.0091   2E-07   46.3   3.0   31   73-103     7-37  (226)
 51 TIGR02902 spore_lonB ATP-depen  95.7   0.011 2.3E-07   50.4   3.7   43   63-105    66-108 (531)
 52 PRK14955 DNA polymerase III su  95.7   0.012 2.5E-07   48.1   3.6   42   62-103    16-58  (397)
 53 PRK14956 DNA polymerase III su  95.7    0.01 2.2E-07   50.5   3.3   42   62-103    18-60  (484)
 54 PRK15455 PrkA family serine pr  95.6   0.012 2.6E-07   51.7   3.6   42   63-104    77-124 (644)
 55 PRK06547 hypothetical protein;  95.6   0.013 2.8E-07   42.9   3.3   17   87-103    19-35  (172)
 56 PRK09376 rho transcription ter  95.6  0.0062 1.3E-07   51.1   1.7   19   87-105   173-191 (416)
 57 PRK14963 DNA polymerase III su  95.6   0.014   3E-07   49.6   3.6   43   62-104    14-57  (504)
 58 PRK14960 DNA polymerase III su  95.5   0.014 3.1E-07   51.7   3.8   42   62-103    15-57  (702)
 59 PRK05896 DNA polymerase III su  95.5   0.014 3.1E-07   50.9   3.7   42   62-103    16-58  (605)
 60 PRK14969 DNA polymerase III su  95.5   0.013 2.9E-07   49.8   3.4   42   62-103    16-58  (527)
 61 PRK13407 bchI magnesium chelat  95.5   0.015 3.1E-07   47.2   3.3   42   62-103     8-49  (334)
 62 PRK08903 DnaA regulatory inact  95.4   0.027 5.8E-07   41.7   4.4   20   86-105    45-64  (227)
 63 PRK14951 DNA polymerase III su  95.4   0.016 3.4E-07   50.6   3.6   42   62-103    16-58  (618)
 64 PRK12323 DNA polymerase III su  95.4   0.016 3.5E-07   51.4   3.6   42   62-103    16-58  (700)
 65 COG2255 RuvB Holliday junction  95.4   0.012 2.5E-07   48.0   2.5   42   62-103    26-72  (332)
 66 PRK08691 DNA polymerase III su  95.3   0.018 3.8E-07   51.2   3.6   42   62-103    16-58  (709)
 67 PF00158 Sigma54_activat:  Sigm  95.3   0.021 4.7E-07   41.6   3.4   42   64-105     1-44  (168)
 68 PRK09111 DNA polymerase III su  95.3   0.021 4.5E-07   49.6   3.8   42   62-103    24-66  (598)
 69 PRK14970 DNA polymerase III su  95.3   0.022 4.7E-07   45.4   3.7   42   62-103    17-59  (367)
 70 PRK08084 DNA replication initi  95.2    0.03 6.6E-07   42.4   4.1   20   86-105    48-67  (235)
 71 PRK03846 adenylylsulfate kinas  95.2   0.013 2.8E-07   43.0   2.0   18   87-104    28-45  (198)
 72 PRK14949 DNA polymerase III su  95.2   0.021 4.6E-07   52.1   3.7   43   62-104    16-59  (944)
 73 PRK07994 DNA polymerase III su  95.1   0.021 4.5E-07   50.2   3.5   42   62-103    16-58  (647)
 74 PRK14950 DNA polymerase III su  95.1   0.022 4.7E-07   48.9   3.5   42   62-103    16-58  (585)
 75 PRK14964 DNA polymerase III su  95.1   0.025 5.3E-07   48.2   3.8   42   62-103    13-55  (491)
 76 cd04155 Arl3 Arl3 subfamily.    95.0   0.027 5.9E-07   39.0   3.2   19   86-104    17-35  (173)
 77 PRK14952 DNA polymerase III su  95.0   0.025 5.4E-07   49.1   3.5   42   62-103    13-55  (584)
 78 KOG2028 ATPase related to the   94.9   0.026 5.7E-07   47.9   3.4   17   87-103   166-182 (554)
 79 PRK06645 DNA polymerase III su  94.9    0.03 6.6E-07   47.8   3.8   43   62-104    21-64  (507)
 80 PRK06893 DNA replication initi  94.9   0.016 3.6E-07   43.7   1.9   19   87-105    43-61  (229)
 81 PRK06620 hypothetical protein;  94.9   0.018   4E-07   43.4   2.1   18   87-104    48-65  (214)
 82 PRK07003 DNA polymerase III su  94.9   0.028 6.1E-07   50.7   3.6   42   62-103    16-58  (830)
 83 COG0714 MoxR-like ATPases [Gen  94.9   0.036 7.9E-07   43.8   3.9   40   62-103    24-63  (329)
 84 PF01078 Mg_chelatase:  Magnesi  94.8   0.032   7E-07   42.8   3.4   40   62-103     3-42  (206)
 85 PRK07764 DNA polymerase III su  94.8   0.031 6.8E-07   50.2   3.8   42   62-103    15-57  (824)
 86 PRK14954 DNA polymerase III su  94.7   0.036 7.8E-07   48.4   3.8   42   62-103    16-58  (620)
 87 TIGR02880 cbbX_cfxQ probable R  94.7   0.042 9.1E-07   43.0   3.8   41   63-103    23-78  (284)
 88 CHL00181 cbbX CbbX; Provisiona  94.7   0.037 7.9E-07   43.6   3.5   43   62-104    23-80  (287)
 89 PRK08727 hypothetical protein;  94.6   0.046   1E-06   41.4   3.8   20   86-105    44-63  (233)
 90 cd00879 Sar1 Sar1 subfamily.    94.6   0.044 9.5E-07   38.8   3.4   20   85-104    21-40  (190)
 91 cd04153 Arl5_Arl8 Arl5/Arl8 su  94.5   0.045 9.7E-07   38.7   3.4   33   72-104     4-36  (174)
 92 TIGR01241 FtsH_fam ATP-depende  94.5   0.041 8.8E-07   46.0   3.6   43   62-104    55-109 (495)
 93 cd03255 ABC_MJ0796_Lo1CDE_FtsE  94.5   0.025 5.4E-07   41.5   2.1   18   87-104    34-51  (218)
 94 TIGR00390 hslU ATP-dependent p  94.5   0.037 7.9E-07   46.9   3.3   42   62-103    12-67  (441)
 95 PRK09112 DNA polymerase III su  94.5   0.048   1E-06   44.3   3.9   42   62-103    23-65  (351)
 96 PRK06305 DNA polymerase III su  94.5   0.041 8.9E-07   46.0   3.5   42   62-103    17-59  (451)
 97 KOG1532 GTPase XAB1, interacts  94.5   0.017 3.8E-07   47.2   1.2   19   87-105    23-41  (366)
 98 PRK05342 clpX ATP-dependent pr  94.4   0.038 8.3E-07   45.9   3.2   43   62-104    71-129 (412)
 99 cd03225 ABC_cobalt_CbiO_domain  94.4   0.027 5.9E-07   41.1   2.1   18   87-104    31-48  (211)
100 cd01130 VirB11-like_ATPase Typ  94.4    0.06 1.3E-06   39.2   3.8   34   70-104    13-46  (186)
101 PRK14953 DNA polymerase III su  94.3    0.05 1.1E-06   46.1   3.7   42   62-103    16-58  (486)
102 PRK09087 hypothetical protein;  94.3   0.029 6.2E-07   42.7   2.1   19   86-104    47-65  (226)
103 TIGR00960 3a0501s02 Type II (G  94.3   0.029 6.2E-07   41.2   2.0   18   87-104    33-50  (216)
104 PRK07940 DNA polymerase III su  94.3   0.049 1.1E-06   45.0   3.5   42   62-103     5-56  (394)
105 PRK11608 pspF phage shock prot  94.3   0.056 1.2E-06   43.1   3.7   44   62-105     6-51  (326)
106 PRK07471 DNA polymerase III su  94.3   0.059 1.3E-06   44.0   3.9   41   62-102    19-60  (365)
107 cd03263 ABC_subfamily_A The AB  94.2   0.031 6.8E-07   41.0   2.1   18   87-104    32-49  (220)
108 cd03261 ABC_Org_Solvent_Resist  94.2   0.032 6.8E-07   41.6   2.0   18   87-104    30-47  (235)
109 cd03256 ABC_PhnC_transporter A  94.1   0.033 7.2E-07   41.4   2.0   18   87-104    31-48  (241)
110 TIGR02640 gas_vesic_GvpN gas v  94.1   0.063 1.4E-06   41.3   3.6   19   86-104    24-42  (262)
111 TIGR02673 FtsE cell division A  94.1   0.034 7.3E-07   40.7   2.0   18   87-104    32-49  (214)
112 TIGR00763 lon ATP-dependent pr  94.1   0.044 9.5E-07   48.5   3.0   43   62-104   320-368 (775)
113 cd03229 ABC_Class3 This class   94.1   0.037 7.9E-07   39.8   2.1   18   87-104    30-47  (178)
114 cd03264 ABC_drug_resistance_li  94.0   0.036 7.8E-07   40.5   2.1   19   86-104    28-46  (211)
115 cd03293 ABC_NrtD_SsuB_transpor  94.0   0.036 7.8E-07   40.9   2.1   18   87-104    34-51  (220)
116 cd03292 ABC_FtsE_transporter F  94.0   0.035 7.6E-07   40.5   2.0   18   87-104    31-48  (214)
117 cd03259 ABC_Carb_Solutes_like   94.0   0.036 7.9E-07   40.6   2.1   18   87-104    30-47  (213)
118 TIGR01166 cbiO cobalt transpor  94.0   0.036 7.8E-07   40.0   2.0   18   87-104    22-39  (190)
119 TIGR02315 ABC_phnC phosphonate  94.0   0.036 7.9E-07   41.3   2.0   18   87-104    32-49  (243)
120 cd03260 ABC_PstB_phosphate_tra  94.0   0.037   8E-07   40.9   2.1   18   87-104    30-47  (227)
121 cd03269 ABC_putative_ATPase Th  94.0   0.037 7.9E-07   40.5   2.0   18   87-104    30-47  (210)
122 TIGR01817 nifA Nif-specific re  94.0    0.07 1.5E-06   44.9   3.9   44   62-105   196-241 (534)
123 PTZ00112 origin recognition co  94.0   0.081 1.7E-06   49.0   4.5   43   62-104   755-802 (1164)
124 PRK05563 DNA polymerase III su  94.0   0.063 1.4E-06   46.1   3.7   42   62-103    16-58  (559)
125 COG1474 CDC6 Cdc6-related prot  94.0   0.089 1.9E-06   43.1   4.4   42   63-104    18-63  (366)
126 PRK05201 hslU ATP-dependent pr  94.0   0.066 1.4E-06   45.4   3.7   42   62-103    15-70  (443)
127 COG1124 DppF ABC-type dipeptid  93.9   0.036 7.8E-07   43.9   2.0   17   87-103    37-53  (252)
128 PTZ00133 ADP-ribosylation fact  93.9   0.072 1.6E-06   38.3   3.5   19   85-103    19-37  (182)
129 PF14532 Sigma54_activ_2:  Sigm  93.9   0.045 9.7E-07   37.9   2.2   41   65-105     1-43  (138)
130 PRK10787 DNA-binding ATP-depen  93.9   0.072 1.6E-06   47.6   4.0   43   62-104   322-370 (784)
131 PRK10584 putative ABC transpor  93.9    0.04 8.6E-07   40.8   2.1   18   87-104    40-57  (228)
132 PF05673 DUF815:  Protein of un  93.9   0.067 1.4E-06   42.2   3.4   43   62-104    27-73  (249)
133 cd03278 ABC_SMC_barmotin Barmo  93.9   0.034 7.4E-07   41.2   1.7   19   87-105    26-44  (197)
134 TIGR00554 panK_bact pantothena  93.9   0.083 1.8E-06   42.1   3.9   17   87-103    66-82  (290)
135 TIGR03864 PQQ_ABC_ATP ABC tran  93.8   0.041 8.9E-07   41.1   2.1   18   87-104    31-48  (236)
136 cd03297 ABC_ModC_molybdenum_tr  93.8    0.04 8.7E-07   40.4   2.0   18   87-104    27-44  (214)
137 cd03258 ABC_MetN_methionine_tr  93.8   0.041 8.9E-07   40.8   2.0   18   87-104    35-52  (233)
138 cd03301 ABC_MalK_N The N-termi  93.8   0.041 8.9E-07   40.2   2.0   18   87-104    30-47  (213)
139 cd03296 ABC_CysA_sulfate_impor  93.8   0.042   9E-07   41.1   2.0   18   87-104    32-49  (239)
140 cd03235 ABC_Metallic_Cations A  93.8   0.041 8.8E-07   40.3   2.0   18   87-104    29-46  (213)
141 PRK13541 cytochrome c biogenes  93.8   0.042   9E-07   40.0   2.0   18   87-104    30-47  (195)
142 TIGR00455 apsK adenylylsulfate  93.8   0.042 9.2E-07   39.5   2.0   18   87-104    22-39  (184)
143 cd03265 ABC_DrrA DrrA is the A  93.8   0.041   9E-07   40.5   2.0   18   87-104    30-47  (220)
144 cd03226 ABC_cobalt_CbiO_domain  93.8   0.043 9.3E-07   40.0   2.0   18   87-104    30-47  (205)
145 TIGR02211 LolD_lipo_ex lipopro  93.8   0.044 9.5E-07   40.3   2.1   18   87-104    35-52  (221)
146 PRK11629 lolD lipoprotein tran  93.7   0.044 9.5E-07   40.8   2.1   18   87-104    39-56  (233)
147 PF13476 AAA_23:  AAA domain; P  93.7    0.05 1.1E-06   38.2   2.3   19   87-105    23-41  (202)
148 cd03219 ABC_Mj1267_LivG_branch  93.7   0.043 9.4E-07   40.7   2.0   18   87-104    30-47  (236)
149 TIGR01243 CDC48 AAA family ATP  93.7   0.059 1.3E-06   47.2   3.1   43   62-104   178-233 (733)
150 cd00820 PEPCK_HprK Phosphoenol  93.7   0.047   1E-06   37.8   2.0   17   87-103    19-35  (107)
151 cd03257 ABC_NikE_OppD_transpor  93.6   0.045 9.7E-07   40.2   2.0   18   87-104    35-52  (228)
152 PRK13538 cytochrome c biogenes  93.6   0.047   1E-06   40.0   2.0   18   87-104    31-48  (204)
153 TIGR03689 pup_AAA proteasome A  93.6   0.077 1.7E-06   45.5   3.6   44   62-105   182-238 (512)
154 PRK06647 DNA polymerase III su  93.6   0.084 1.8E-06   45.5   3.8   42   62-103    16-58  (563)
155 PRK14738 gmk guanylate kinase;  93.6   0.049 1.1E-06   40.5   2.1   18   87-104    17-34  (206)
156 cd03266 ABC_NatA_sodium_export  93.6   0.046   1E-06   40.1   2.0   18   87-104    35-52  (218)
157 PRK14965 DNA polymerase III su  93.6   0.078 1.7E-06   45.6   3.6   42   62-103    16-58  (576)
158 smart00178 SAR Sar1p-like memb  93.6   0.091   2E-06   37.7   3.5   32   72-103     5-37  (184)
159 TIGR01978 sufC FeS assembly AT  93.6   0.046   1E-06   40.6   2.0   18   87-104    30-47  (243)
160 TIGR03608 L_ocin_972_ABC putat  93.6    0.05 1.1E-06   39.5   2.1   18   87-104    28-45  (206)
161 TIGR00602 rad24 checkpoint pro  93.6   0.075 1.6E-06   46.7   3.5   43   62-104    84-131 (637)
162 PTZ00361 26 proteosome regulat  93.6   0.072 1.6E-06   44.7   3.3   43   63-105   184-239 (438)
163 cd03224 ABC_TM1139_LivF_branch  93.6   0.048   1E-06   40.0   2.0   18   87-104    30-47  (222)
164 TIGR00150 HI0065_YjeE ATPase,   93.5    0.11 2.4E-06   37.1   3.8   36   69-104     6-43  (133)
165 cd03295 ABC_OpuCA_Osmoprotecti  93.5    0.05 1.1E-06   40.8   2.1   18   87-104    31-48  (242)
166 cd03273 ABC_SMC2_euk Eukaryoti  93.5   0.047   1E-06   41.3   1.9   19   87-105    29-47  (251)
167 COG3899 Predicted ATPase [Gene  93.5   0.072 1.6E-06   47.9   3.3   41   64-104     2-45  (849)
168 PRK10536 hypothetical protein;  93.5   0.093   2E-06   41.7   3.6   40   62-103    55-94  (262)
169 COG0529 CysC Adenylylsulfate k  93.4   0.053 1.1E-06   41.5   2.1   18   87-104    25-44  (197)
170 TIGR02974 phageshock_pspF psp   93.4   0.084 1.8E-06   42.3   3.3   42   64-105     1-44  (329)
171 PRK06526 transposase; Provisio  93.4   0.053 1.2E-06   42.1   2.1   19   85-103   100-118 (254)
172 PRK11124 artP arginine transpo  93.4   0.053 1.1E-06   40.5   2.1   18   87-104    32-49  (242)
173 PLN02200 adenylate kinase fami  93.4   0.051 1.1E-06   41.6   2.0   17   87-103    47-63  (234)
174 TIGR00764 lon_rel lon-related   93.4   0.077 1.7E-06   46.1   3.3   41   62-104    18-58  (608)
175 cd03218 ABC_YhbG The ABC trans  93.4   0.053 1.1E-06   40.1   2.0   18   87-104    30-47  (232)
176 PRK10247 putative ABC transpor  93.4   0.055 1.2E-06   40.3   2.1   18   87-104    37-54  (225)
177 cd03252 ABCC_Hemolysin The ABC  93.4   0.054 1.2E-06   40.3   2.0   18   87-104    32-49  (237)
178 PRK14948 DNA polymerase III su  93.4   0.096 2.1E-06   45.7   3.8   42   62-103    16-58  (620)
179 cd03268 ABC_BcrA_bacitracin_re  93.4   0.056 1.2E-06   39.4   2.1   18   87-104    30-47  (208)
180 PRK11264 putative amino-acid A  93.4   0.054 1.2E-06   40.6   2.0   18   87-104    33-50  (250)
181 PRK14245 phosphate ABC transpo  93.3   0.053 1.2E-06   40.8   2.0   18   87-104    33-50  (250)
182 PRK11300 livG leucine/isoleuci  93.3   0.054 1.2E-06   40.7   2.0   18   87-104    35-52  (255)
183 TIGR02324 CP_lyasePhnL phospho  93.3   0.056 1.2E-06   39.8   2.0   18   87-104    38-55  (224)
184 PRK11248 tauB taurine transpor  93.3   0.055 1.2E-06   41.3   2.1   18   87-104    31-48  (255)
185 TIGR00972 3a0107s01c2 phosphat  93.3   0.055 1.2E-06   40.6   2.0   17   87-103    31-47  (247)
186 PRK09493 glnQ glutamine ABC tr  93.3   0.056 1.2E-06   40.3   2.0   18   87-104    31-48  (240)
187 cd03262 ABC_HisP_GlnQ_permease  93.3   0.058 1.2E-06   39.3   2.0   18   87-104    30-47  (213)
188 TIGR03598 GTPase_YsxC ribosome  93.2   0.079 1.7E-06   37.7   2.6   20   85-104    20-39  (179)
189 TIGR01277 thiQ thiamine ABC tr  93.2    0.06 1.3E-06   39.6   2.0   18   87-104    28-45  (213)
190 PRK14247 phosphate ABC transpo  93.2   0.058 1.2E-06   40.5   2.0   18   87-104    33-50  (250)
191 PRK14242 phosphate transporter  93.2    0.06 1.3E-06   40.5   2.1   18   87-104    36-53  (253)
192 PRK10619 histidine/lysine/argi  93.2   0.058 1.3E-06   40.8   2.0   18   87-104    35-52  (257)
193 TIGR00382 clpX endopeptidase C  93.2    0.11 2.4E-06   43.4   3.8   43   62-104    77-137 (413)
194 PRK10908 cell division protein  93.2   0.061 1.3E-06   39.7   2.1   18   87-104    32-49  (222)
195 PRK09183 transposase/IS protei  93.2    0.06 1.3E-06   41.7   2.1   19   86-104   105-123 (259)
196 PTZ00454 26S protease regulato  93.2     0.1 2.2E-06   43.2   3.5   44   62-105   145-201 (398)
197 PRK05642 DNA replication initi  93.1   0.059 1.3E-06   40.9   2.0   19   87-105    49-67  (234)
198 PRK07133 DNA polymerase III su  93.1     0.1 2.3E-06   46.5   3.7   42   62-103    18-60  (725)
199 PRK11701 phnK phosphonate C-P   93.1   0.063 1.4E-06   40.7   2.1   18   87-104    36-53  (258)
200 cd03223 ABCD_peroxisomal_ALDP   93.1   0.066 1.4E-06   38.2   2.1   18   87-104    31-48  (166)
201 cd03249 ABC_MTABC3_MDL1_MDL2 M  93.1   0.067 1.4E-06   39.8   2.2   18   87-104    33-50  (238)
202 TIGR03410 urea_trans_UrtE urea  93.1   0.062 1.4E-06   39.8   2.0   18   87-104    30-47  (230)
203 PRK15177 Vi polysaccharide exp  93.1   0.064 1.4E-06   39.9   2.0   19   86-104    16-34  (213)
204 cd03247 ABCC_cytochrome_bd The  93.1   0.066 1.4E-06   38.4   2.0   18   87-104    32-49  (178)
205 cd03267 ABC_NatA_like Similar   93.1   0.063 1.4E-06   40.3   2.0   18   87-104    51-68  (236)
206 PRK15429 formate hydrogenlyase  93.1    0.12 2.7E-06   44.8   4.0   44   62-105   376-421 (686)
207 PRK13539 cytochrome c biogenes  93.0   0.066 1.4E-06   39.3   2.1   18   87-104    32-49  (207)
208 PRK13540 cytochrome c biogenes  93.0   0.065 1.4E-06   39.1   2.0   18   87-104    31-48  (200)
209 CHL00131 ycf16 sulfate ABC tra  93.0   0.063 1.4E-06   40.3   2.0   18   87-104    37-54  (252)
210 PRK14274 phosphate ABC transpo  93.0   0.063 1.4E-06   40.7   2.0   18   87-104    42-59  (259)
211 cd03251 ABCC_MsbA MsbA is an e  93.0   0.065 1.4E-06   39.7   2.0   18   87-104    32-49  (234)
212 TIGR00750 lao LAO/AO transport  93.0    0.11 2.5E-06   40.7   3.5   33   71-103    20-54  (300)
213 PRK10895 lipopolysaccharide AB  93.0   0.064 1.4E-06   40.1   2.0   17   87-103    33-49  (241)
214 PRK14250 phosphate ABC transpo  93.0   0.066 1.4E-06   40.2   2.1   18   87-104    33-50  (241)
215 TIGR01189 ccmA heme ABC export  93.0   0.067 1.4E-06   38.9   2.0   18   87-104    30-47  (198)
216 cd03240 ABC_Rad50 The catalyti  93.0   0.064 1.4E-06   39.8   1.9   18   87-104    26-43  (204)
217 cd03222 ABC_RNaseL_inhibitor T  93.0   0.063 1.4E-06   39.5   1.9   18   87-104    29-46  (177)
218 PRK14239 phosphate transporter  93.0   0.067 1.5E-06   40.1   2.0   18   87-104    35-52  (252)
219 TIGR02639 ClpA ATP-dependent C  93.0    0.14 2.9E-06   45.1   4.2   43   62-104   454-505 (731)
220 cd03237 ABC_RNaseL_inhibitor_d  93.0   0.065 1.4E-06   40.9   2.0   18   87-104    29-46  (246)
221 KOG0734 AAA+-type ATPase conta  92.9   0.081 1.7E-06   46.7   2.7   42   62-103   304-357 (752)
222 cd03272 ABC_SMC3_euk Eukaryoti  92.9   0.069 1.5E-06   39.8   2.0   18   87-104    27-44  (243)
223 PRK14241 phosphate transporter  92.9   0.067 1.4E-06   40.5   2.0   18   87-104    34-51  (258)
224 PRK11831 putative ABC transpor  92.9   0.066 1.4E-06   41.0   2.0   18   87-104    37-54  (269)
225 PRK14267 phosphate ABC transpo  92.9   0.067 1.5E-06   40.2   2.0   18   87-104    34-51  (253)
226 cd03215 ABC_Carb_Monos_II This  92.9    0.07 1.5E-06   38.4   2.0   18   87-104    30-47  (182)
227 PRK14248 phosphate ABC transpo  92.9   0.068 1.5E-06   40.8   2.0   18   87-104    51-68  (268)
228 PRK09544 znuC high-affinity zi  92.9   0.071 1.5E-06   40.7   2.1   18   87-104    34-51  (251)
229 TIGR02868 CydC thiol reductant  92.9   0.071 1.5E-06   44.3   2.2   19   86-104   364-382 (529)
230 PRK10575 iron-hydroxamate tran  92.9   0.068 1.5E-06   40.8   1.9   18   87-104    41-58  (265)
231 cd03214 ABC_Iron-Siderophores_  92.9   0.075 1.6E-06   38.2   2.1   18   87-104    29-46  (180)
232 KOG0991 Replication factor C,   92.9    0.13 2.8E-06   41.5   3.6   41   62-102    27-67  (333)
233 PRK10744 pstB phosphate transp  92.8    0.07 1.5E-06   40.5   2.0   18   87-104    43-60  (260)
234 PRK10418 nikD nickel transport  92.8   0.072 1.6E-06   40.3   2.0   18   87-104    33-50  (254)
235 TIGR03873 F420-0_ABC_ATP propo  92.8   0.071 1.5E-06   40.3   2.0   18   87-104    31-48  (256)
236 cd03246 ABCC_Protease_Secretio  92.8   0.075 1.6E-06   38.0   2.0   18   87-104    32-49  (173)
237 cd03230 ABC_DR_subfamily_A Thi  92.8   0.075 1.6E-06   38.0   2.0   18   87-104    30-47  (173)
238 PRK08099 bifunctional DNA-bind  92.8   0.069 1.5E-06   44.1   2.0   18   87-104   223-240 (399)
239 PRK14256 phosphate ABC transpo  92.8   0.072 1.6E-06   40.1   2.0   18   87-104    34-51  (252)
240 PRK14238 phosphate transporter  92.8   0.071 1.5E-06   40.9   2.0   18   87-104    54-71  (271)
241 cd03233 ABC_PDR_domain1 The pl  92.8   0.072 1.6E-06   39.1   1.9   18   87-104    37-54  (202)
242 PF13604 AAA_30:  AAA domain; P  92.8    0.18 3.9E-06   37.2   4.1   32   72-104     7-39  (196)
243 PRK14261 phosphate ABC transpo  92.8   0.073 1.6E-06   40.1   2.0   18   87-104    36-53  (253)
244 COG1116 TauB ABC-type nitrate/  92.8   0.071 1.5E-06   42.1   2.0   17   87-103    33-49  (248)
245 PRK13638 cbiO cobalt transport  92.8   0.072 1.6E-06   40.8   2.0   18   87-104    31-48  (271)
246 PRK13649 cbiO cobalt transport  92.7   0.074 1.6E-06   40.8   2.0   18   87-104    37-54  (280)
247 cd03290 ABCC_SUR1_N The SUR do  92.7   0.077 1.7E-06   39.0   2.1   18   87-104    31-48  (218)
248 PRK14262 phosphate ABC transpo  92.7   0.074 1.6E-06   39.9   2.0   18   87-104    33-50  (250)
249 cd03221 ABCF_EF-3 ABCF_EF-3  E  92.7   0.079 1.7E-06   37.1   2.0   18   87-104    30-47  (144)
250 PRK15093 antimicrobial peptide  92.7   0.072 1.6E-06   42.4   2.0   18   87-104    37-54  (330)
251 PRK09580 sufC cysteine desulfu  92.7   0.074 1.6E-06   39.7   2.0   18   87-104    31-48  (248)
252 PRK14255 phosphate ABC transpo  92.7   0.075 1.6E-06   40.0   2.0   18   87-104    35-52  (252)
253 PRK11034 clpA ATP-dependent Cl  92.7    0.15 3.3E-06   45.5   4.2   42   62-103   458-508 (758)
254 KOG2004 Mitochondrial ATP-depe  92.7    0.11 2.4E-06   47.0   3.3   42   62-103   411-458 (906)
255 cd03279 ABC_sbcCD SbcCD and ot  92.7   0.071 1.5E-06   39.5   1.8   18   87-104    32-49  (213)
256 PRK11247 ssuB aliphatic sulfon  92.7   0.075 1.6E-06   40.9   2.0   18   87-104    42-59  (257)
257 CHL00176 ftsH cell division pr  92.7   0.086 1.9E-06   46.2   2.6   43   62-104   183-237 (638)
258 cd03245 ABCC_bacteriocin_expor  92.7   0.078 1.7E-06   38.9   2.0   18   87-104    34-51  (220)
259 cd03294 ABC_Pro_Gly_Bertaine T  92.7   0.078 1.7E-06   40.7   2.1   18   87-104    54-71  (269)
260 PRK14260 phosphate ABC transpo  92.7   0.079 1.7E-06   40.2   2.1   18   87-104    37-54  (259)
261 cd03220 ABC_KpsT_Wzt ABC_KpsT_  92.7   0.078 1.7E-06   39.6   2.0   18   87-104    52-69  (224)
262 PRK11231 fecE iron-dicitrate t  92.7   0.077 1.7E-06   40.1   2.0   18   87-104    32-49  (255)
263 cd03248 ABCC_TAP TAP, the Tran  92.6   0.082 1.8E-06   39.0   2.1   18   87-104    44-61  (226)
264 cd03232 ABC_PDR_domain2 The pl  92.6   0.082 1.8E-06   38.5   2.1   18   87-104    37-54  (192)
265 PRK11022 dppD dipeptide transp  92.6   0.073 1.6E-06   42.4   1.9   18   87-104    37-54  (326)
266 PF13086 AAA_11:  AAA domain; P  92.6   0.087 1.9E-06   37.6   2.1   16   87-102    21-36  (236)
267 PRK14237 phosphate transporter  92.6   0.081 1.8E-06   40.5   2.1   18   87-104    50-67  (267)
268 cd03238 ABC_UvrA The excision   92.6   0.081 1.8E-06   38.9   2.0   18   87-104    25-42  (176)
269 COG4608 AppF ABC-type oligopep  92.6   0.079 1.7E-06   42.2   2.1   17   87-103    43-59  (268)
270 cd03253 ABCC_ATM1_transporter   92.6   0.083 1.8E-06   39.2   2.1   18   87-104    31-48  (236)
271 PRK14259 phosphate ABC transpo  92.6    0.08 1.7E-06   40.6   2.0   18   87-104    43-60  (269)
272 cd03244 ABCC_MRP_domain2 Domai  92.6   0.082 1.8E-06   38.8   2.0   18   87-104    34-51  (221)
273 COG1120 FepC ABC-type cobalami  92.6   0.085 1.8E-06   41.7   2.2   19   87-105    32-50  (258)
274 TIGR00767 rho transcription te  92.6   0.069 1.5E-06   44.9   1.8   19   87-105   172-190 (415)
275 cd03228 ABCC_MRP_Like The MRP   92.6   0.088 1.9E-06   37.5   2.1   18   87-104    32-49  (171)
276 TIGR02782 TrbB_P P-type conjug  92.6   0.073 1.6E-06   42.2   1.8   21   85-105   134-154 (299)
277 PRK05022 anaerobic nitric oxid  92.6    0.16 3.5E-06   42.7   4.0   44   62-105   187-232 (509)
278 cd03234 ABCG_White The White s  92.6   0.081 1.8E-06   39.2   2.0   18   87-104    37-54  (226)
279 PRK14265 phosphate ABC transpo  92.5   0.083 1.8E-06   40.7   2.1   18   87-104    50-67  (274)
280 TIGR03005 ectoine_ehuA ectoine  92.5   0.083 1.8E-06   39.8   2.0   18   87-104    30-47  (252)
281 PRK10771 thiQ thiamine transpo  92.5   0.083 1.8E-06   39.3   2.0   18   87-104    29-46  (232)
282 PRK14240 phosphate transporter  92.5   0.084 1.8E-06   39.6   2.0   18   87-104    33-50  (250)
283 PRK13645 cbiO cobalt transport  92.5   0.082 1.8E-06   40.9   2.0   18   87-104    41-58  (289)
284 PF00025 Arf:  ADP-ribosylation  92.5    0.12 2.6E-06   37.0   2.8   20   85-104    16-35  (175)
285 PRK14243 phosphate transporter  92.5   0.083 1.8E-06   40.4   2.0   18   87-104    40-57  (264)
286 PRK08451 DNA polymerase III su  92.5    0.16 3.4E-06   43.8   3.9   42   62-103    14-56  (535)
287 TIGR02788 VirB11 P-type DNA tr  92.5    0.17 3.7E-06   39.9   3.8   19   86-104   147-165 (308)
288 PRK15056 manganese/iron transp  92.5   0.083 1.8E-06   40.5   2.0   18   87-104    37-54  (272)
289 PRK14270 phosphate ABC transpo  92.5   0.085 1.8E-06   39.7   2.0   18   87-104    34-51  (251)
290 cd03298 ABC_ThiQ_thiamine_tran  92.5   0.086 1.9E-06   38.5   2.0   18   87-104    28-45  (211)
291 PLN02796 D-glycerate 3-kinase   92.5   0.083 1.8E-06   43.4   2.1   18   87-104   104-121 (347)
292 PRK08154 anaerobic benzoate ca  92.4    0.15 3.4E-06   40.2   3.5   17   87-103   137-153 (309)
293 PRK14266 phosphate ABC transpo  92.4    0.09   2E-06   39.5   2.1   18   87-104    33-50  (250)
294 cd04154 Arl2 Arl2 subfamily.    92.4   0.093   2E-06   36.7   2.0   20   85-104    16-35  (173)
295 PRK00454 engB GTP-binding prot  92.4   0.096 2.1E-06   37.0   2.1   21   85-105    26-46  (196)
296 TIGR01188 drrA daunorubicin re  92.4   0.085 1.9E-06   41.2   2.0   18   87-104    23-40  (302)
297 TIGR02442 Cob-chelat-sub cobal  92.4    0.15 3.2E-06   44.3   3.6   43   62-104     4-46  (633)
298 TIGR03499 FlhF flagellar biosy  92.4   0.085 1.8E-06   41.3   2.0   17   87-103   198-214 (282)
299 PRK14251 phosphate ABC transpo  92.4   0.088 1.9E-06   39.5   2.0   18   87-104    34-51  (251)
300 PLN02318 phosphoribulokinase/u  92.4    0.14   3E-06   45.3   3.4   18   87-104    69-86  (656)
301 cd03216 ABC_Carb_Monos_I This   92.4   0.095 2.1E-06   37.3   2.1   18   87-104    30-47  (163)
302 PRK14244 phosphate ABC transpo  92.4   0.092   2E-06   39.5   2.1   18   87-104    35-52  (251)
303 PRK13543 cytochrome c biogenes  92.4   0.093   2E-06   38.7   2.1   18   87-104    41-58  (214)
304 PF08298 AAA_PrkA:  PrkA AAA do  92.3    0.12 2.6E-06   42.7   2.9   42   62-103    61-108 (358)
305 PRK14273 phosphate ABC transpo  92.3    0.09   2E-06   39.6   2.0   18   87-104    37-54  (254)
306 KOG1547 Septin CDC10 and relat  92.3    0.14 3.1E-06   41.4   3.1   43   63-105    25-68  (336)
307 cd01394 radB RadB. The archaea  92.3   0.092   2E-06   38.5   2.0   17   87-103    23-39  (218)
308 PRK14235 phosphate transporter  92.3   0.093   2E-06   40.1   2.1   18   87-104    49-66  (267)
309 cd01129 PulE-GspE PulE/GspE Th  92.3     0.2 4.2E-06   39.0   3.9   39   65-103    62-100 (264)
310 PRK14253 phosphate ABC transpo  92.2   0.094   2E-06   39.3   2.0   18   87-104    33-50  (249)
311 PRK13548 hmuV hemin importer A  92.2   0.094   2E-06   39.9   2.0   18   87-104    32-49  (258)
312 TIGR02323 CP_lyasePhnK phospho  92.2   0.096 2.1E-06   39.4   2.0   18   87-104    33-50  (253)
313 cd03369 ABCC_NFT1 Domain 2 of   92.2   0.098 2.1E-06   38.2   2.0   18   87-104    38-55  (207)
314 COG1123 ATPase components of v  92.2   0.088 1.9E-06   45.6   2.0   17   87-103   321-337 (539)
315 TIGR00362 DnaA chromosomal rep  92.2   0.091   2E-06   42.6   2.0   19   87-105   140-158 (405)
316 PRK13650 cbiO cobalt transport  92.1   0.099 2.2E-06   40.4   2.1   18   87-104    37-54  (279)
317 cd03254 ABCC_Glucan_exporter_l  92.1     0.1 2.2E-06   38.5   2.0   17   87-103    33-49  (229)
318 PRK13640 cbiO cobalt transport  92.1   0.099 2.2E-06   40.4   2.0   18   87-104    37-54  (282)
319 PRK14272 phosphate ABC transpo  92.1     0.1 2.2E-06   39.2   2.0   18   87-104    34-51  (252)
320 cd00267 ABC_ATPase ABC (ATP-bi  92.1    0.11 2.4E-06   36.3   2.1   18   87-104    29-46  (157)
321 PRK11614 livF leucine/isoleuci  92.1     0.1 2.2E-06   38.9   2.0   18   87-104    35-52  (237)
322 TIGR03740 galliderm_ABC gallid  92.0     0.1 2.3E-06   38.5   2.0   18   87-104    30-47  (223)
323 cd03231 ABC_CcmA_heme_exporter  92.0     0.1 2.3E-06   38.1   2.0   18   87-104    30-47  (201)
324 PF13245 AAA_19:  Part of AAA d  92.0    0.12 2.5E-06   33.3   2.0   17   87-103    14-31  (76)
325 PF03193 DUF258:  Protein of un  92.0    0.17 3.7E-06   37.3   3.1   32   69-104    24-56  (161)
326 PRK05439 pantothenate kinase;   92.0    0.22 4.8E-06   40.1   4.0   17   87-103    90-106 (311)
327 PRK13632 cbiO cobalt transport  92.0     0.1 2.3E-06   39.9   2.1   18   87-104    39-56  (271)
328 PRK10419 nikE nickel transport  92.0     0.1 2.3E-06   40.0   2.0   18   87-104    42-59  (268)
329 PRK13648 cbiO cobalt transport  92.0     0.1 2.3E-06   39.8   2.0   18   87-104    39-56  (269)
330 PRK09473 oppD oligopeptide tra  92.0   0.096 2.1E-06   41.9   1.8   18   87-104    46-63  (330)
331 PRK11153 metN DL-methionine tr  92.0     0.1 2.2E-06   41.8   2.0   18   87-104    35-52  (343)
332 COG1121 ZnuC ABC-type Mn/Zn tr  91.9     0.1 2.2E-06   41.2   2.0   18   87-104    34-51  (254)
333 PRK09984 phosphonate/organopho  91.9     0.1 2.3E-06   39.5   2.0   18   87-104    34-51  (262)
334 PRK14269 phosphate ABC transpo  91.9    0.11 2.4E-06   39.1   2.1   18   87-104    32-49  (246)
335 PRK13646 cbiO cobalt transport  91.9    0.11 2.4E-06   40.3   2.1   18   87-104    37-54  (286)
336 PRK14959 DNA polymerase III su  91.9    0.18 3.9E-06   44.3   3.6   42   62-103    16-58  (624)
337 PRK11308 dppF dipeptide transp  91.9     0.1 2.3E-06   41.6   2.0   18   87-104    45-62  (327)
338 PRK14236 phosphate transporter  91.9    0.11 2.3E-06   39.9   2.0   18   87-104    55-72  (272)
339 PRK08116 hypothetical protein;  91.9     0.1 2.3E-06   40.6   1.9   20   86-105   117-136 (268)
340 PRK13546 teichoic acids export  91.9    0.11 2.3E-06   40.2   2.0   18   87-104    54-71  (264)
341 PF00308 Bac_DnaA:  Bacterial d  91.9    0.33 7.1E-06   36.6   4.6   44   62-105     9-56  (219)
342 PRK14268 phosphate ABC transpo  91.8    0.11 2.4E-06   39.4   2.0   18   87-104    42-59  (258)
343 PRK05537 bifunctional sulfate   91.8    0.21 4.5E-06   43.2   3.8   18   87-104   396-413 (568)
344 PRK13647 cbiO cobalt transport  91.8    0.11 2.4E-06   40.0   2.0   18   87-104    35-52  (274)
345 PRK10253 iron-enterobactin tra  91.8    0.11 2.4E-06   39.6   1.9   18   87-104    37-54  (265)
346 TIGR02769 nickel_nikE nickel i  91.8    0.11 2.4E-06   39.6   2.0   18   87-104    41-58  (265)
347 cd01878 HflX HflX subfamily.    91.8    0.12 2.7E-06   37.1   2.1   19   86-104    44-62  (204)
348 PRK14971 DNA polymerase III su  91.8    0.19 4.1E-06   43.8   3.6   42   62-103    17-59  (614)
349 TIGR03411 urea_trans_UrtD urea  91.7    0.12 2.6E-06   38.5   2.0   18   87-104    32-49  (242)
350 COG2274 SunT ABC-type bacterio  91.7    0.11 2.3E-06   46.2   2.0   18   86-103   502-519 (709)
351 cd03236 ABC_RNaseL_inhibitor_d  91.7    0.12 2.6E-06   39.8   2.1   18   87-104    30-47  (255)
352 PRK14271 phosphate ABC transpo  91.7    0.12 2.6E-06   39.9   2.1   18   87-104    51-68  (276)
353 PRK14252 phosphate ABC transpo  91.7    0.12 2.6E-06   39.4   2.0   18   87-104    46-63  (265)
354 PRK14249 phosphate ABC transpo  91.7    0.12 2.6E-06   38.9   2.0   17   87-103    34-50  (251)
355 COG0542 clpA ATP-binding subun  91.6    0.18   4E-06   45.4   3.4   42   62-103   491-541 (786)
356 cd03250 ABCC_MRP_domain1 Domai  91.6    0.12 2.7E-06   37.5   2.0   18   87-104    35-52  (204)
357 PRK15112 antimicrobial peptide  91.6    0.12 2.6E-06   39.5   2.0   18   87-104    43-60  (267)
358 smart00350 MCM minichromosome   91.6    0.21 4.5E-06   42.2   3.6   44   62-105   203-258 (509)
359 PRK03695 vitamin B12-transport  91.6    0.12 2.6E-06   39.1   2.0   18   87-104    26-43  (248)
360 PRK13547 hmuV hemin importer A  91.6    0.12 2.6E-06   40.0   2.0   18   87-104    31-48  (272)
361 KOG0738 AAA+-type ATPase [Post  91.6    0.19 4.2E-06   42.8   3.3   44   62-105   212-267 (491)
362 TIGR02982 heterocyst_DevA ABC   91.6    0.13 2.7E-06   38.0   2.0   18   87-104    35-52  (220)
363 PRK13639 cbiO cobalt transport  91.6    0.12 2.7E-06   39.7   2.0   18   87-104    32-49  (275)
364 PRK10923 glnG nitrogen regulat  91.6    0.25 5.4E-06   40.3   3.9   44   62-105   138-183 (469)
365 TIGR01650 PD_CobS cobaltochela  91.6    0.36 7.8E-06   39.4   4.8   32   70-103    53-84  (327)
366 PRK11176 lipid transporter ATP  91.6    0.12 2.5E-06   43.5   2.0   19   86-104   372-390 (582)
367 cd01123 Rad51_DMC1_radA Rad51_  91.6    0.13 2.8E-06   38.0   2.0   18   87-104    23-40  (235)
368 COG1132 MdlB ABC-type multidru  91.5    0.12 2.7E-06   43.4   2.2   20   86-105   358-377 (567)
369 PRK14275 phosphate ABC transpo  91.5    0.12 2.7E-06   40.1   2.0   18   87-104    69-86  (286)
370 TIGR03346 chaperone_ClpB ATP-d  91.5    0.17 3.6E-06   45.4   3.0   43   62-104   565-616 (852)
371 TIGR01288 nodI ATP-binding ABC  91.5    0.12 2.7E-06   40.3   2.0   18   87-104    34-51  (303)
372 KOG0731 AAA+-type ATPase conta  91.5    0.11 2.5E-06   46.6   1.9   42   62-103   311-364 (774)
373 PRK13652 cbiO cobalt transport  91.5    0.13 2.8E-06   39.7   2.0   18   87-104    34-51  (277)
374 PRK14258 phosphate ABC transpo  91.5    0.13 2.9E-06   39.1   2.1   18   87-104    37-54  (261)
375 PRK10865 protein disaggregatio  91.5    0.24 5.3E-06   44.6   4.0   43   62-104   568-619 (857)
376 TIGR02314 ABC_MetN D-methionin  91.4    0.12 2.7E-06   41.7   2.0   18   87-104    35-52  (343)
377 cd03291 ABCC_CFTR1 The CFTR su  91.4    0.13 2.8E-06   40.3   2.1   18   87-104    67-84  (282)
378 PRK13641 cbiO cobalt transport  91.4    0.13 2.9E-06   39.8   2.1   18   87-104    37-54  (287)
379 PRK12422 chromosomal replicati  91.4    0.12 2.7E-06   43.2   2.0   19   87-105   145-163 (445)
380 PRK15079 oligopeptide ABC tran  91.3    0.13 2.8E-06   41.2   2.0   18   87-104    51-68  (331)
381 PRK11388 DNA-binding transcrip  91.3    0.26 5.7E-06   42.3   3.9   44   62-105   325-370 (638)
382 TIGR02142 modC_ABC molybdenum   91.3    0.13 2.9E-06   41.2   2.1   18   87-104    27-44  (354)
383 PRK14088 dnaA chromosomal repl  91.3    0.13 2.8E-06   42.8   2.0   20   86-105   133-152 (440)
384 COG1136 SalX ABC-type antimicr  91.3    0.14 2.9E-06   39.8   2.0   18   87-104    35-52  (226)
385 PRK13651 cobalt transporter AT  91.3    0.14   3E-06   40.5   2.0   18   87-104    37-54  (305)
386 PRK11144 modC molybdate transp  91.3    0.13 2.9E-06   41.3   2.0   18   87-104    28-45  (352)
387 PRK15134 microcin C ABC transp  91.2    0.13 2.8E-06   43.1   2.0   18   87-104    39-56  (529)
388 PRK13636 cbiO cobalt transport  91.2    0.14 3.1E-06   39.6   2.1   18   87-104    36-53  (283)
389 PRK13643 cbiO cobalt transport  91.2    0.14 3.1E-06   39.8   2.0   18   87-104    36-53  (288)
390 cd03275 ABC_SMC1_euk Eukaryoti  91.2    0.14   3E-06   38.8   1.9   19   87-105    26-44  (247)
391 PF13481 AAA_25:  AAA domain; P  91.1    0.18 3.9E-06   35.9   2.4   17   87-103    36-52  (193)
392 TIGR01526 nadR_NMN_Atrans nico  91.1    0.14 3.1E-06   41.0   2.0   18   86-103   165-182 (325)
393 PRK13637 cbiO cobalt transport  91.1    0.15 3.2E-06   39.6   2.0   18   87-104    37-54  (287)
394 PRK13644 cbiO cobalt transport  91.1    0.15 3.2E-06   39.3   2.1   18   87-104    32-49  (274)
395 PRK14264 phosphate ABC transpo  91.0    0.15 3.3E-06   40.0   2.1   18   87-104    75-92  (305)
396 cd03213 ABCG_EPDR ABCG transpo  91.0    0.15 3.4E-06   37.1   2.0   18   87-104    39-56  (194)
397 PRK13631 cbiO cobalt transport  91.0    0.15 3.3E-06   40.5   2.1   18   87-104    56-73  (320)
398 PLN02348 phosphoribulokinase    91.0    0.24 5.2E-06   41.4   3.3   18   87-104    53-70  (395)
399 PRK10463 hydrogenase nickel in  91.0    0.19 4.1E-06   40.3   2.6   17   87-103   108-124 (290)
400 PRK10938 putative molybdenum t  91.0    0.15 3.2E-06   42.2   2.0   18   87-104    33-50  (490)
401 cd03217 ABC_FeS_Assembly ABC-t  91.0    0.16 3.4E-06   37.2   2.0   18   87-104    30-47  (200)
402 TIGR03269 met_CoM_red_A2 methy  90.9    0.15 3.2E-06   42.6   2.0   18   87-104    30-47  (520)
403 PRK13765 ATP-dependent proteas  90.9    0.21 4.6E-06   43.9   3.0   41   62-104    31-71  (637)
404 smart00177 ARF ARF-like small   90.9    0.24 5.2E-06   35.1   2.9   19   85-103    15-33  (175)
405 cd03283 ABC_MutS-like MutS-lik  90.9    0.16 3.4E-06   37.8   2.0   17   87-103    29-45  (199)
406 TIGR02633 xylG D-xylose ABC tr  90.9    0.15 3.2E-06   42.3   2.0   18   87-104    31-48  (500)
407 PRK11000 maltose/maltodextrin   90.9    0.15 3.2E-06   41.4   2.0   18   87-104    33-50  (369)
408 TIGR00968 3a0106s01 sulfate AB  90.9    0.16 3.4E-06   38.1   2.0   18   87-104    30-47  (237)
409 PRK10762 D-ribose transporter   90.9    0.15 3.2E-06   42.4   2.0   18   87-104    34-51  (501)
410 TIGR03797 NHPM_micro_ABC2 NHPM  90.9    0.16 3.4E-06   43.8   2.2   19   86-104   482-500 (686)
411 cd03300 ABC_PotA_N PotA is an   90.9    0.17 3.6E-06   37.7   2.1   18   87-104    30-47  (232)
412 PRK04841 transcriptional regul  90.9    0.25 5.3E-06   43.0   3.4   33   71-103    19-52  (903)
413 PRK13851 type IV secretion sys  90.9    0.32   7E-06   39.6   3.9   20   86-105   165-184 (344)
414 PRK14254 phosphate ABC transpo  90.9    0.16 3.4E-06   39.5   2.0   18   87-104    69-86  (285)
415 PRK10416 signal recognition pa  90.8    0.16 3.4E-06   40.8   2.0   17   87-103   118-134 (318)
416 PRK15064 ABC transporter ATP-b  90.8    0.16 3.4E-06   42.6   2.0   18   87-104    31-48  (530)
417 PRK10820 DNA-binding transcrip  90.8    0.29 6.3E-06   41.5   3.6   43   63-105   205-249 (520)
418 CHL00095 clpC Clp protease ATP  90.7    0.23 4.9E-06   44.4   3.1   42   62-103   509-559 (821)
419 PRK00149 dnaA chromosomal repl  90.7    0.16 3.4E-06   42.0   2.0   19   87-105   152-170 (450)
420 TIGR00073 hypB hydrogenase acc  90.7    0.17 3.6E-06   37.3   1.9   18   87-104    26-43  (207)
421 PRK13635 cbiO cobalt transport  90.7    0.17 3.7E-06   39.1   2.0   18   87-104    37-54  (279)
422 cd01855 YqeH YqeH.  YqeH is an  90.7    0.32 6.8E-06   35.0   3.3   34   71-104   113-148 (190)
423 PRK14263 phosphate ABC transpo  90.6    0.17 3.7E-06   38.7   2.0   18   87-104    38-55  (261)
424 PRK11174 cysteine/glutathione   90.6    0.17 3.7E-06   42.6   2.2   19   86-104   379-397 (588)
425 PRK13642 cbiO cobalt transport  90.6    0.18 3.8E-06   38.9   2.0   18   87-104    37-54  (277)
426 cd03299 ABC_ModC_like Archeal   90.6    0.18 3.8E-06   37.8   2.0   18   87-104    29-46  (235)
427 PRK13634 cbiO cobalt transport  90.6    0.17 3.8E-06   39.3   2.0   18   87-104    37-54  (290)
428 PRK13549 xylose transporter AT  90.6    0.16 3.5E-06   42.2   2.0   18   87-104   292-309 (506)
429 PRK05703 flhF flagellar biosyn  90.6    0.17 3.6E-06   42.2   2.0   17   87-103   225-241 (424)
430 PRK13549 xylose transporter AT  90.6    0.17 3.6E-06   42.2   2.0   18   87-104    35-52  (506)
431 PRK09435 membrane ATPase/prote  90.5    0.33 7.2E-06   39.4   3.7   33   71-103    42-76  (332)
432 TIGR00064 ftsY signal recognit  90.5    0.18 3.8E-06   39.5   2.0   17   87-103    76-92  (272)
433 cd03289 ABCC_CFTR2 The CFTR su  90.5    0.18 3.9E-06   39.3   2.1   18   87-104    34-51  (275)
434 PRK11889 flhF flagellar biosyn  90.5    0.17 3.7E-06   42.9   2.0   17   87-103   245-261 (436)
435 PF01695 IstB_IS21:  IstB-like   90.5    0.22 4.7E-06   36.5   2.3   18   86-103    50-67  (178)
436 PRK15439 autoinducer 2 ABC tra  90.5    0.18 3.8E-06   42.2   2.1   18   87-104    41-58  (510)
437 PRK10982 galactose/methyl gala  90.4    0.17 3.6E-06   41.9   1.9   18   87-104   278-295 (491)
438 COG3842 PotA ABC-type spermidi  90.4    0.17 3.8E-06   41.6   2.0   17   87-103    35-51  (352)
439 PRK15064 ABC transporter ATP-b  90.4    0.18 3.8E-06   42.3   2.0   18   87-104   349-366 (530)
440 PRK10261 glutathione transport  90.4    0.17 3.8E-06   43.5   2.0   18   87-104    46-63  (623)
441 PRK09361 radB DNA repair and r  90.4    0.19   4E-06   37.2   1.9   18   87-104    27-44  (225)
442 TIGR01193 bacteriocin_ABC ABC-  90.4    0.17 3.7E-06   43.7   2.0   19   86-104   503-521 (708)
443 PRK08533 flagellar accessory p  90.3    0.19 4.1E-06   38.2   2.0   16   87-102    28-43  (230)
444 PRK09700 D-allose transporter   90.3    0.18 3.8E-06   42.0   2.0   18   87-104    35-52  (510)
445 PRK15134 microcin C ABC transp  90.3    0.18 3.9E-06   42.2   2.0   18   87-104   316-333 (529)
446 PRK10982 galactose/methyl gala  90.3    0.18 3.9E-06   41.8   1.9   18   87-104    28-45  (491)
447 PRK09700 D-allose transporter   90.3    0.18 3.9E-06   41.9   2.0   18   87-104   293-310 (510)
448 PRK11288 araG L-arabinose tran  90.3    0.18   4E-06   41.9   2.0   18   87-104    34-51  (501)
449 PRK13633 cobalt transporter AT  90.3     0.2 4.2E-06   38.7   2.0   18   87-104    40-57  (280)
450 PF05970 PIF1:  PIF1-like helic  90.2    0.35 7.6E-06   39.0   3.6   32   73-104    12-43  (364)
451 PLN02165 adenylate isopentenyl  90.2    0.19 4.1E-06   41.1   2.0   17   87-103    47-63  (334)
452 cd03288 ABCC_SUR2 The SUR doma  90.2    0.21 4.5E-06   38.0   2.1   18   87-104    51-68  (257)
453 PRK11432 fbpC ferric transport  90.2    0.19 4.1E-06   40.6   2.0   18   87-104    36-53  (351)
454 PF13555 AAA_29:  P-loop contai  90.1    0.23   5E-06   31.3   1.9   18   87-104    27-44  (62)
455 PHA02244 ATPase-like protein    90.1    0.36 7.7E-06   40.3   3.6   21   85-105   121-141 (383)
456 TIGR02329 propionate_PrpR prop  90.1    0.36 7.8E-06   41.4   3.7   43   63-105   213-257 (526)
457 PRK10762 D-ribose transporter   90.1    0.19 4.2E-06   41.7   2.0   18   87-104   282-299 (501)
458 PRK15439 autoinducer 2 ABC tra  90.1    0.19 4.1E-06   42.0   1.9   18   87-104   293-310 (510)
459 PLN03071 GTP-binding nuclear p  90.1    0.22 4.7E-06   37.1   2.1   19   85-103    15-33  (219)
460 PRK07952 DNA replication prote  90.0     0.2 4.4E-06   38.8   1.9   18   87-104   103-120 (244)
461 cd03270 ABC_UvrA_I The excisio  90.0    0.18   4E-06   37.8   1.7   14   87-100    25-38  (226)
462 TIGR03345 VI_ClpV1 type VI sec  90.0    0.43 9.3E-06   43.1   4.2   42   62-103   566-616 (852)
463 PRK10261 glutathione transport  90.0     0.2 4.3E-06   43.1   2.1   18   87-104   354-371 (623)
464 PRK11819 putative ABC transpor  90.0     0.2 4.3E-06   42.4   2.0   18   87-104   354-371 (556)
465 TIGR03796 NHPM_micro_ABC1 NHPM  90.0    0.19 4.2E-06   43.4   2.0   19   86-104   508-526 (710)
466 COG1119 ModF ABC-type molybden  90.0    0.21 4.5E-06   39.7   2.0   17   87-103    61-77  (257)
467 PRK15424 propionate catabolism  90.0    0.37   8E-06   41.5   3.6   44   62-105   219-264 (538)
468 cd01858 NGP_1 NGP-1.  Autoanti  89.9    0.25 5.4E-06   34.6   2.2   18   87-104   106-123 (157)
469 PRK12377 putative replication   89.9    0.21 4.5E-06   38.9   1.9   19   86-104   104-122 (248)
470 PRK12724 flagellar biosynthesi  89.9     0.2 4.4E-06   42.3   2.0   17   87-103   227-243 (432)
471 cd03274 ABC_SMC4_euk Eukaryoti  89.9    0.21 4.6E-06   37.4   1.9   18   87-104    29-46  (212)
472 TIGR03269 met_CoM_red_A2 methy  89.9    0.21 4.5E-06   41.7   2.1   18   87-104   314-331 (520)
473 PRK10522 multidrug transporter  89.9    0.22 4.8E-06   41.8   2.2   19   86-104   352-370 (547)
474 PRK14257 phosphate ABC transpo  89.9    0.21 4.6E-06   39.9   2.1   18   87-104   112-129 (329)
475 PRK10938 putative molybdenum t  89.9     0.2 4.4E-06   41.4   2.0   18   87-104   290-307 (490)
476 COG2884 FtsE Predicted ATPase   89.9    0.22 4.9E-06   38.7   2.1   19   87-105    32-50  (223)
477 PRK14246 phosphate ABC transpo  89.9    0.21 4.6E-06   38.1   2.0   17   87-103    40-56  (257)
478 PLN03118 Rab family protein; P  89.9    0.22 4.9E-06   36.3   2.0   19   85-103    16-34  (211)
479 TIGR01842 type_I_sec_PrtD type  89.8    0.23   5E-06   41.6   2.2   19   86-104   347-365 (544)
480 PRK10851 sulfate/thiosulfate t  89.8    0.22 4.7E-06   40.3   2.0   18   87-104    32-49  (353)
481 cd01393 recA_like RecA is a  b  89.7    0.22 4.7E-06   36.5   1.8   19   85-103    20-39  (226)
482 COG0470 HolB ATPase involved i  89.7    0.57 1.2E-05   35.7   4.2   41   63-103     2-44  (325)
483 PRK03003 GTP-binding protein D  89.6    0.38 8.3E-06   40.1   3.4   19   86-104    41-59  (472)
484 PRK14722 flhF flagellar biosyn  89.6    0.22 4.8E-06   41.1   2.0   17   87-103   141-157 (374)
485 PLN02674 adenylate kinase       89.6    0.23 5.1E-06   38.7   2.0   18   86-103    34-51  (244)
486 PRK11650 ugpC glycerol-3-phosp  89.6    0.23 4.9E-06   40.2   2.0   18   87-104    34-51  (356)
487 TIGR03719 ABC_ABC_ChvD ATP-bin  89.6    0.22 4.7E-06   42.1   1.9   18   87-104   352-369 (552)
488 PF02562 PhoH:  PhoH-like prote  89.6    0.26 5.6E-06   37.6   2.2   35   65-102     3-38  (205)
489 COG0396 sufC Cysteine desulfur  89.6    0.23   5E-06   39.3   1.9   17   87-103    34-50  (251)
490 KOG1969 DNA replication checkp  89.5     0.2 4.3E-06   45.4   1.7   17   87-103   330-346 (877)
491 PLN00223 ADP-ribosylation fact  89.5    0.25 5.4E-06   35.5   2.0   20   85-104    19-38  (181)
492 TIGR03522 GldA_ABC_ATP gliding  89.5    0.24 5.1E-06   38.8   2.0   18   87-104    32-49  (301)
493 TIGR02857 CydD thiol reductant  89.5    0.25 5.3E-06   41.1   2.2   19   86-104   351-369 (529)
494 PF06068 TIP49:  TIP49 C-termin  89.5     0.6 1.3E-05   39.2   4.4   42   62-103    24-70  (398)
495 COG1855 ATPase (PilT family) [  89.5     0.3 6.4E-06   42.4   2.7   33   71-104   252-284 (604)
496 COG0410 LivF ABC-type branched  89.4    0.25 5.3E-06   38.9   2.0   18   87-104    33-50  (237)
497 PRK10070 glycine betaine trans  89.4    0.23   5E-06   41.1   1.9   18   87-104    58-75  (400)
498 PRK10636 putative ABC transpor  89.4    0.23   5E-06   43.0   2.0   19   86-104    30-48  (638)
499 PRK11819 putative ABC transpor  89.4    0.24 5.2E-06   41.9   2.0   18   87-104    37-54  (556)
500 KOG0062 ATPase component of AB  89.3    0.24 5.1E-06   43.2   2.0   19   85-103   108-126 (582)

No 1  
>PF00931 NB-ARC:  NB-ARC domain;  InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []. This domain has been structurally characterised in the human protein apoptotic protease-activating factor 1 (Apaf-1) []. It contains the three-layered alpha-beta fold and subsequent short alpha-helical region characteristic of the AAA+ ATPase domain superfamily. While this domain is thought to bind and hyrolyse ATP, only ADP binding has been experimentally verified. It is proposed that binding and hydrolysis of ATP by this domain induces conformational changes the the overall protein, leading to formation of the apoptosome.; GO: 0043531 ADP binding; PDB: 3IZA_E 1Z6T_D 3SFZ_A 3SHF_A 1VT4_M 3IZ8_G 3LQR_A 2A5Y_C 3LQQ_A.
Probab=98.70  E-value=1.7e-08  Score=76.33  Aligned_cols=39  Identities=26%  Similarity=0.464  Sum_probs=32.3

Q ss_pred             cchhHHHHHHHHhcCCCC-Cc-ceEecCCCcHHHHHHhhhc
Q 046733           67 RDGDRNKIINRLSALNDV-DT-VIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        67 rd~~~~~lv~~L~~~~~~-~~-~IvGmGGiGKTTLA~~Vy~  105 (106)
                      ||.++++|.+.|...... .+ .|+||||+||||||..+|+
T Consensus         1 re~~~~~l~~~L~~~~~~~~~v~I~G~~G~GKT~LA~~~~~   41 (287)
T PF00931_consen    1 REKEIEKLKDWLLDNSNEVRVVAIVGMGGIGKTTLARQVAR   41 (287)
T ss_dssp             -HHHHHHHHHHHHTTTTSSEEEEEEESTTSSHHHHHHHHHC
T ss_pred             CHHHHHHHHHHhhCCCCCeEEEEEEcCCcCCcceeeeeccc
Confidence            678999999999875432 34 9999999999999999875


No 2  
>PLN03210 Resistant to P. syringae 6; Provisional
Probab=98.68  E-value=1.4e-08  Score=91.82  Aligned_cols=44  Identities=20%  Similarity=0.266  Sum_probs=36.6

Q ss_pred             CceeecchhHHHHHHHHhcCCC-CCc-ceEecCCCcHHHHHHhhhc
Q 046733           62 KFAYGRDGDRNKIINRLSALND-VDT-VIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~-~~~-~IvGmGGiGKTTLA~~Vy~  105 (106)
                      .++||++...++|..+|..... .++ +||||||+||||||+.+|+
T Consensus       184 ~~~vG~~~~l~~l~~lL~l~~~~~~vvgI~G~gGiGKTTLA~~l~~  229 (1153)
T PLN03210        184 EDFVGIEDHIAKMSSLLHLESEEVRMVGIWGSSGIGKTTIARALFS  229 (1153)
T ss_pred             ccccchHHHHHHHHHHHccccCceEEEEEEcCCCCchHHHHHHHHH
Confidence            5799999999999988854332 244 9999999999999999985


No 3  
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]
Probab=98.66  E-value=1.7e-08  Score=90.11  Aligned_cols=54  Identities=26%  Similarity=0.288  Sum_probs=45.2

Q ss_pred             ccccccccccccCCCceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhhhc
Q 046733           48 KTLGEALNFFSKYNKFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        48 ~~~~~t~s~~~e~~~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~Vy~  105 (106)
                      +..+++.+...+  .+ ||.+..++++.+.|+..+. .+ +|+||||+||||||+.||+
T Consensus       147 ~~~~e~~~~~~~--~~-VG~e~~~~kl~~~L~~d~~-~iv~i~GMGGvGKTTL~~qi~N  201 (889)
T KOG4658|consen  147 REKVETRPIQSE--SD-VGLETMLEKLWNRLMEDDV-GIVGIYGMGGVGKTTLARQIFN  201 (889)
T ss_pred             hhhcccCCCCcc--cc-ccHHHHHHHHHHHhccCCC-CEEEEECCCcccHHHHHHHHhc
Confidence            445666666666  55 9999999999999988666 45 9999999999999999986


No 4  
>PF13191 AAA_16:  AAA ATPase domain; PDB: 2V1U_A.
Probab=97.88  E-value=7.6e-06  Score=57.56  Aligned_cols=42  Identities=19%  Similarity=0.336  Sum_probs=28.4

Q ss_pred             eeecchhHHHHHHHHhcCC--CCCc-ceEecCCCcHHHHHHhhhc
Q 046733           64 AYGRDGDRNKIINRLSALN--DVDT-VIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        64 vvGrd~~~~~lv~~L~~~~--~~~~-~IvGmGGiGKTTLA~~Vy~  105 (106)
                      ++||+++.+.+...|....  ..+. -|+|..|+|||+|.+.+++
T Consensus         2 fvgR~~e~~~l~~~l~~~~~~~~~~~ll~G~~G~GKT~ll~~~~~   46 (185)
T PF13191_consen    2 FVGREEEIERLRDLLDAAQSGSPRNLLLTGESGSGKTSLLRALLD   46 (185)
T ss_dssp             -TT-HHHHHHHHHTTGGTSS-----EEE-B-TTSSHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHcCCCcEEEEECCCCCCHHHHHHHHHH
Confidence            6899999999999884221  2233 8889999999999997653


No 5  
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=97.70  E-value=4.8e-05  Score=49.82  Aligned_cols=40  Identities=18%  Similarity=0.219  Sum_probs=30.0

Q ss_pred             ecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhhhc
Q 046733           66 GRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        66 Grd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      |++...+.+...+.......+-|+|..|+|||||++.++.
T Consensus         2 ~~~~~~~~i~~~~~~~~~~~v~i~G~~G~GKT~l~~~i~~   41 (151)
T cd00009           2 GQEEAIEALREALELPPPKNLLLYGPPGTGKTTLARAIAN   41 (151)
T ss_pred             chHHHHHHHHHHHhCCCCCeEEEECCCCCCHHHHHHHHHH
Confidence            6677777777776543233348999999999999998864


No 6  
>PF01637 Arch_ATPase:  Archaeal ATPase;  InterPro: IPR011579  This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP.; GO: 0005524 ATP binding; PDB: 2FNA_A 2QEN_A.
Probab=97.67  E-value=3.1e-05  Score=55.63  Aligned_cols=41  Identities=22%  Similarity=0.353  Sum_probs=30.6

Q ss_pred             eeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhhh
Q 046733           64 AYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        64 vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+||+.+.++|.+++.......+.|+|..|+|||+|.+.+.
T Consensus         1 F~gR~~el~~l~~~l~~~~~~~~~l~G~rg~GKTsLl~~~~   41 (234)
T PF01637_consen    1 FFGREKELEKLKELLESGPSQHILLYGPRGSGKTSLLKEFI   41 (234)
T ss_dssp             S-S-HHHHHHHHHCHHH--SSEEEEEESTTSSHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHhhcCcEEEEEcCCcCCHHHHHHHHH
Confidence            47999999999998865433333888999999999999764


No 7  
>TIGR02928 orc1/cdc6 family replication initiation protein. Members of this protein family are found exclusively in the archaea. This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. Several members may be found in genome and interact with each other.
Probab=97.55  E-value=0.00011  Score=57.75  Aligned_cols=44  Identities=23%  Similarity=0.222  Sum_probs=35.1

Q ss_pred             CceeecchhHHHHHHHHhc---CCC-CCcceEecCCCcHHHHHHhhhc
Q 046733           62 KFAYGRDGDRNKIINRLSA---LND-VDTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~---~~~-~~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      ..++||+++.+.|...|..   ... ..+-|+|..|+|||++++.++.
T Consensus        15 ~~l~gRe~e~~~l~~~l~~~~~~~~~~~i~I~G~~GtGKT~l~~~~~~   62 (365)
T TIGR02928        15 DRIVHRDEQIEELAKALRPILRGSRPSNVFIYGKTGTGKTAVTKYVMK   62 (365)
T ss_pred             CCCCCcHHHHHHHHHHHHHHHcCCCCCcEEEECCCCCCHHHHHHHHHH
Confidence            4799999999999998853   111 2348899999999999998863


No 8  
>CHL00095 clpC Clp protease ATP binding subunit
Probab=97.36  E-value=0.00019  Score=63.60  Aligned_cols=42  Identities=19%  Similarity=0.429  Sum_probs=36.4

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~V  103 (106)
                      ..++||+++.++++..|......++-++|..|+|||++|+.+
T Consensus       179 ~~~igr~~ei~~~~~~L~r~~~~n~lL~G~pGvGKTal~~~l  220 (821)
T CHL00095        179 DPVIGREKEIERVIQILGRRTKNNPILIGEPGVGKTAIAEGL  220 (821)
T ss_pred             CCCCCcHHHHHHHHHHHcccccCCeEEECCCCCCHHHHHHHH
Confidence            468999999999999998765555689999999999999865


No 9  
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.
Probab=97.35  E-value=0.00018  Score=55.39  Aligned_cols=43  Identities=19%  Similarity=0.244  Sum_probs=33.0

Q ss_pred             CceeecchhHHHHHHHHhcC---CC-C-CcceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSAL---ND-V-DTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~---~~-~-~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .++||+++.++.|..++...   .. . .+-++|+.|+|||+||+.+.
T Consensus         4 ~~~iG~~~~~~~l~~~l~~~~~~~~~~~~~ll~Gp~G~GKT~la~~ia   51 (305)
T TIGR00635         4 AEFIGQEKVKEQLQLFIEAAKMRQEALDHLLLYGPPGLGKTTLAHIIA   51 (305)
T ss_pred             HHHcCHHHHHHHHHHHHHHHHhcCCCCCeEEEECCCCCCHHHHHHHHH
Confidence            46899999999988877531   11 1 23788999999999999864


No 10 
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.
Probab=97.22  E-value=0.00035  Score=62.49  Aligned_cols=42  Identities=24%  Similarity=0.437  Sum_probs=36.2

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~V  103 (106)
                      ..++||+++.++++..|......+.-++|..|+||||||..+
T Consensus       187 d~~iGr~~ei~~~i~~l~r~~~~n~lLvG~pGvGKTal~~~L  228 (852)
T TIGR03345       187 DPVLGRDDEIRQMIDILLRRRQNNPILTGEAGVGKTAVVEGL  228 (852)
T ss_pred             CcccCCHHHHHHHHHHHhcCCcCceeEECCCCCCHHHHHHHH
Confidence            468999999999999997765555578999999999999865


No 11 
>PRK00411 cdc6 cell division control protein 6; Reviewed
Probab=97.19  E-value=0.00046  Score=54.86  Aligned_cols=44  Identities=18%  Similarity=0.247  Sum_probs=34.8

Q ss_pred             CceeecchhHHHHHHHHhcC---CC-CCcceEecCCCcHHHHHHhhhc
Q 046733           62 KFAYGRDGDRNKIINRLSAL---ND-VDTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~---~~-~~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      ..++||+++.+.|...|...   .. ..+-|+|..|+|||++++.++.
T Consensus        30 ~~l~~Re~e~~~l~~~l~~~~~~~~~~~~lI~G~~GtGKT~l~~~v~~   77 (394)
T PRK00411         30 ENLPHREEQIEELAFALRPALRGSRPLNVLIYGPPGTGKTTTVKKVFE   77 (394)
T ss_pred             CCCCCHHHHHHHHHHHHHHHhCCCCCCeEEEECCCCCCHHHHHHHHHH
Confidence            57999999999998887432   11 1338899999999999998863


No 12 
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA.
Probab=97.19  E-value=0.00041  Score=60.69  Aligned_cols=43  Identities=21%  Similarity=0.370  Sum_probs=36.2

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      ..++||+++.++++..|......++-++|..|+|||+||+.+-
T Consensus       182 ~~~igr~~ei~~~~~~L~~~~~~n~lL~G~pG~GKT~l~~~la  224 (731)
T TIGR02639       182 DPLIGREDELERTIQVLCRRKKNNPLLVGEPGVGKTAIAEGLA  224 (731)
T ss_pred             CcccCcHHHHHHHHHHHhcCCCCceEEECCCCCCHHHHHHHHH
Confidence            3699999999999988876655556888999999999998753


No 13 
>PRK10865 protein disaggregation chaperone; Provisional
Probab=97.14  E-value=0.00047  Score=61.63  Aligned_cols=42  Identities=24%  Similarity=0.425  Sum_probs=36.1

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~V  103 (106)
                      ..++||+++.++++..|......+.-++|..|+|||+||..+
T Consensus       178 ~~vigr~~ei~~~i~iL~r~~~~n~lL~G~pGvGKT~l~~~l  219 (857)
T PRK10865        178 DPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGL  219 (857)
T ss_pred             CcCCCCHHHHHHHHHHHhcCCcCceEEECCCCCCHHHHHHHH
Confidence            469999999999999998765555588899999999999864


No 14 
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed
Probab=97.03  E-value=0.00062  Score=53.70  Aligned_cols=43  Identities=19%  Similarity=0.255  Sum_probs=32.9

Q ss_pred             CceeecchhHHHHHHHHhcC---CC-C-CcceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSAL---ND-V-DTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~---~~-~-~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+++|+++.++.+..++...   .. . .+-|+|+.|+||||||+.+.
T Consensus        25 ~~~vG~~~~~~~l~~~l~~~~~~~~~~~~~ll~GppG~GKT~la~~ia   72 (328)
T PRK00080         25 DEFIGQEKVKENLKIFIEAAKKRGEALDHVLLYGPPGLGKTTLANIIA   72 (328)
T ss_pred             HHhcCcHHHHHHHHHHHHHHHhcCCCCCcEEEECCCCccHHHHHHHHH
Confidence            46999999999887776431   11 1 23788999999999999874


No 15 
>PRK13342 recombination factor protein RarA; Reviewed
Probab=96.98  E-value=0.00049  Score=56.20  Aligned_cols=42  Identities=17%  Similarity=0.109  Sum_probs=29.3

Q ss_pred             ceeecchhHHH---HHHHHhcCCCCCcceEecCCCcHHHHHHhhh
Q 046733           63 FAYGRDGDRNK---IINRLSALNDVDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        63 ~vvGrd~~~~~---lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      ++||+++.+..   |..++.......+-++|..|+||||||+.+.
T Consensus        13 d~vGq~~~v~~~~~L~~~i~~~~~~~ilL~GppGtGKTtLA~~ia   57 (413)
T PRK13342         13 EVVGQEHLLGPGKPLRRMIEAGRLSSMILWGPPGTGKTTLARIIA   57 (413)
T ss_pred             HhcCcHHHhCcchHHHHHHHcCCCceEEEECCCCCCHHHHHHHHH
Confidence            57787765444   5555544333334788999999999999875


No 16 
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins.
Probab=96.90  E-value=0.0011  Score=59.10  Aligned_cols=42  Identities=26%  Similarity=0.441  Sum_probs=35.4

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~V  103 (106)
                      ..++||+++.++++..|......+.-++|..|+|||+||..+
T Consensus       173 ~~~igr~~ei~~~~~~l~r~~~~n~lL~G~pGvGKT~l~~~l  214 (852)
T TIGR03346       173 DPVIGRDEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIVEGL  214 (852)
T ss_pred             CcCCCcHHHHHHHHHHHhcCCCCceEEEcCCCCCHHHHHHHH
Confidence            359999999999999997755445578899999999999865


No 17 
>PHA02544 44 clamp loader, small subunit; Provisional
Probab=96.86  E-value=0.0014  Score=50.80  Aligned_cols=44  Identities=14%  Similarity=0.003  Sum_probs=34.7

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhhhc
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~Vy~  105 (106)
                      .+++|.++.++.+..++......+. -++|..|+||||+|+.++.
T Consensus        21 ~~~~~~~~~~~~l~~~~~~~~~~~~lll~G~~G~GKT~la~~l~~   65 (316)
T PHA02544         21 DECILPAADKETFKSIVKKGRIPNMLLHSPSPGTGKTTVAKALCN   65 (316)
T ss_pred             HHhcCcHHHHHHHHHHHhcCCCCeEEEeeCcCCCCHHHHHHHHHH
Confidence            4689999999999988865433333 5579999999999998753


No 18 
>smart00763 AAA_PrkA PrkA AAA domain. This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain.
Probab=96.84  E-value=0.0013  Score=54.17  Aligned_cols=49  Identities=16%  Similarity=0.299  Sum_probs=37.7

Q ss_pred             ccccccccCCCceeecchhHHHHHHHHhcCCC----C-Cc-ceEecCCCcHHHHHHhh
Q 046733           52 EALNFFSKYNKFAYGRDGDRNKIINRLSALND----V-DT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        52 ~t~s~~~e~~~~vvGrd~~~~~lv~~L~~~~~----~-~~-~IvGmGGiGKTTLA~~V  103 (106)
                      ....++.   .+++|.++.++++++++.....    . .+ .++|..|.||||||+.+
T Consensus        44 ~~y~~F~---~~~~G~~~~i~~lv~~l~~~a~g~~~~r~il~L~GPPGsGKStla~~L   98 (361)
T smart00763       44 KRYRFFD---HDFFGMEEAIERFVNYFKSAAQGLEERKQILYLLGPVGGGKSSLVECL   98 (361)
T ss_pred             eeccccc---hhccCcHHHHHHHHHHHHHHHhcCCCCCcEEEEECCCCCCHHHHHHHH
Confidence            3444554   3799999999999999864221    1 33 89999999999999976


No 19 
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family. Members of this protein family resemble the widely distributed ATP-dependent protease La, also called Lon and LonA. It resembles even more closely LonB, which is a LonA paralog found in genomes if and only if the species is capable of endospore formation (as in Bacillus subtilis, Clostridium tetani, and select other members of the Firmicutes) and expressed specifically in the forespore compartment. Members of this family are restricted to a subset of spore-forming species, and are very likely to participate in the program of endospore formation. We propose the designation LonC.
Probab=96.81  E-value=0.0013  Score=56.94  Aligned_cols=44  Identities=11%  Similarity=0.168  Sum_probs=34.7

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhhhc
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      ++++|++.....+.+.+.......+-|+|..|+||||||+.++.
T Consensus       154 ~~iiGqs~~~~~l~~~ia~~~~~~vlL~Gp~GtGKTTLAr~i~~  197 (615)
T TIGR02903       154 SEIVGQERAIKALLAKVASPFPQHIILYGPPGVGKTTAARLALE  197 (615)
T ss_pred             HhceeCcHHHHHHHHHHhcCCCCeEEEECCCCCCHHHHHHHHHH
Confidence            46899999888888777543333458899999999999998864


No 20 
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional
Probab=96.72  E-value=0.0018  Score=57.45  Aligned_cols=43  Identities=21%  Similarity=0.370  Sum_probs=36.6

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      ..++||+++.++++..|......++-++|..|+|||+||+.+.
T Consensus       186 ~~liGR~~ei~~~i~iL~r~~~~n~LLvGppGvGKT~lae~la  228 (758)
T PRK11034        186 DPLIGREKELERAIQVLCRRRKNNPLLVGESGVGKTAIAEGLA  228 (758)
T ss_pred             CcCcCCCHHHHHHHHHHhccCCCCeEEECCCCCCHHHHHHHHH
Confidence            4699999999999998877554455889999999999999865


No 21 
>PRK06696 uridine kinase; Validated
Probab=96.71  E-value=0.0019  Score=48.33  Aligned_cols=38  Identities=21%  Similarity=0.215  Sum_probs=26.9

Q ss_pred             cchhHHHHHHHHhcCCCC-C-c-ceEecCCCcHHHHHHhhh
Q 046733           67 RDGDRNKIINRLSALNDV-D-T-VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        67 rd~~~~~lv~~L~~~~~~-~-~-~IvGmGGiGKTTLA~~Vy  104 (106)
                      |++-++.|.+.+...... . + .|-|.+|.||||||+.+-
T Consensus         3 ~~~~~~~la~~~~~~~~~~~~iI~I~G~sgsGKSTlA~~L~   43 (223)
T PRK06696          3 RKQLIKELAEHILTLNLTRPLRVAIDGITASGKTTFADELA   43 (223)
T ss_pred             HHHHHHHHHHHHHHhCCCCceEEEEECCCCCCHHHHHHHHH
Confidence            445566777777543322 2 2 889999999999999764


No 22 
>PRK00440 rfc replication factor C small subunit; Reviewed
Probab=96.65  E-value=0.0023  Score=48.98  Aligned_cols=43  Identities=14%  Similarity=0.116  Sum_probs=34.1

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+++|+++.++.+..++.......+-++|..|.||||+|+.+.
T Consensus        17 ~~~~g~~~~~~~l~~~i~~~~~~~~ll~G~~G~GKt~~~~~l~   59 (319)
T PRK00440         17 DEIVGQEEIVERLKSYVKEKNMPHLLFAGPPGTGKTTAALALA   59 (319)
T ss_pred             HHhcCcHHHHHHHHHHHhCCCCCeEEEECCCCCCHHHHHHHHH
Confidence            4688999989888888865333234788999999999999864


No 23 
>PF05496 RuvB_N:  Holliday junction DNA helicase ruvB N-terminus;  InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein []. This group of sequences contain this signature which is located in the N-terminal region of the proteins.; GO: 0009378 four-way junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination; PDB: 1IQP_B 3PFI_B 1IXR_C 1HQC_B 1IXS_B.
Probab=96.60  E-value=0.0016  Score=50.83  Aligned_cols=42  Identities=19%  Similarity=0.207  Sum_probs=27.4

Q ss_pred             CceeecchhHHHHHHHHhc--CCCC---CcceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSA--LNDV---DTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~--~~~~---~~~IvGmGGiGKTTLA~~V  103 (106)
                      .++||.++-++.+.-++..  .+..   .+-.+|.+|+||||||..+
T Consensus        24 ~efiGQ~~l~~~l~i~i~aa~~r~~~l~h~lf~GPPG~GKTTLA~II   70 (233)
T PF05496_consen   24 DEFIGQEHLKGNLKILIRAAKKRGEALDHMLFYGPPGLGKTTLARII   70 (233)
T ss_dssp             CCS-S-HHHHHHHHHHHHHHHCTTS---EEEEESSTTSSHHHHHHHH
T ss_pred             HHccCcHHHHhhhHHHHHHHHhcCCCcceEEEECCCccchhHHHHHH
Confidence            4699999877775444422  1111   2377899999999999975


No 24 
>PRK12402 replication factor C small subunit 2; Reviewed
Probab=96.59  E-value=0.0025  Score=49.22  Aligned_cols=43  Identities=16%  Similarity=0.200  Sum_probs=32.9

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+++|++..++.+..++.......+-++|..|+||||+|+.+.
T Consensus        15 ~~~~g~~~~~~~L~~~~~~~~~~~lll~Gp~GtGKT~la~~~~   57 (337)
T PRK12402         15 EDILGQDEVVERLSRAVDSPNLPHLLVQGPPGSGKTAAVRALA   57 (337)
T ss_pred             HHhcCCHHHHHHHHHHHhCCCCceEEEECCCCCCHHHHHHHHH
Confidence            4688999988888887755432224788999999999998753


No 25 
>PTZ00202 tuzin; Provisional
Probab=96.56  E-value=0.004  Score=53.52  Aligned_cols=43  Identities=19%  Similarity=0.305  Sum_probs=34.3

Q ss_pred             CceeecchhHHHHHHHHhcCCCC--Cc-ceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDV--DT-VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~--~~-~IvGmGGiGKTTLA~~Vy  104 (106)
                      ..++||+.+...|...|...+..  .+ .|.|+.|.|||||++.+.
T Consensus       262 ~~FVGReaEla~Lr~VL~~~d~~~privvLtG~~G~GKTTLlR~~~  307 (550)
T PTZ00202        262 RQFVSREAEESWVRQVLRRLDTAHPRIVVFTGFRGCGKSSLCRSAV  307 (550)
T ss_pred             cCCCCcHHHHHHHHHHHhccCCCCceEEEEECCCCCCHHHHHHHHH
Confidence            68999999999998887543322  34 889999999999988754


No 26 
>PRK07667 uridine kinase; Provisional
Probab=96.48  E-value=0.0038  Score=45.92  Aligned_cols=35  Identities=23%  Similarity=0.270  Sum_probs=25.3

Q ss_pred             hHHHHHHHHhcCCCCCc--ceEecCCCcHHHHHHhhh
Q 046733           70 DRNKIINRLSALNDVDT--VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        70 ~~~~lv~~L~~~~~~~~--~IvGmGGiGKTTLA~~Vy  104 (106)
                      +.+.|++.|......+.  .|-|..|.||||||+.+.
T Consensus         2 ~~~~~~~~~~~~~~~~~iIgI~G~~gsGKStla~~L~   38 (193)
T PRK07667          2 STNELINIMKKHKENRFILGIDGLSRSGKTTFVANLK   38 (193)
T ss_pred             CHHHHHHHHHhcCCCCEEEEEECCCCCCHHHHHHHHH
Confidence            35667766654443333  888999999999999764


No 27 
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional
Probab=96.46  E-value=0.0029  Score=53.60  Aligned_cols=41  Identities=20%  Similarity=0.328  Sum_probs=33.4

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .++++.++..+.++..|....  ++-+.|++|+|||++|+.+.
T Consensus       175 ~d~~i~e~~le~l~~~L~~~~--~iil~GppGtGKT~lA~~la  215 (459)
T PRK11331        175 NDLFIPETTIETILKRLTIKK--NIILQGPPGVGKTFVARRLA  215 (459)
T ss_pred             hcccCCHHHHHHHHHHHhcCC--CEEEECCCCCCHHHHHHHHH
Confidence            468888889999998886432  34888999999999999874


No 28 
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional
Probab=96.43  E-value=0.0034  Score=50.54  Aligned_cols=42  Identities=21%  Similarity=0.220  Sum_probs=33.3

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.++-++.+.+.+...+.... -+.|..|+||||+|+.+
T Consensus        16 ~~iiGq~~~~~~l~~~~~~~~~~h~~L~~Gp~G~GKTtla~~l   58 (363)
T PRK14961         16 RDIIGQKHIVTAISNGLSLGRIHHAWLLSGTRGVGKTTIARLL   58 (363)
T ss_pred             hhccChHHHHHHHHHHHHcCCCCeEEEEecCCCCCHHHHHHHH
Confidence            4699999989888887765443332 68899999999999875


No 29 
>PLN03025 replication factor C subunit; Provisional
Probab=96.36  E-value=0.0042  Score=48.90  Aligned_cols=43  Identities=14%  Similarity=0.098  Sum_probs=31.9

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+++|.++-++.|..++.......+-++|..|+||||+|+.+-
T Consensus        13 ~~~~g~~~~~~~L~~~~~~~~~~~lll~Gp~G~GKTtla~~la   55 (319)
T PLN03025         13 DDIVGNEDAVSRLQVIARDGNMPNLILSGPPGTGKTTSILALA   55 (319)
T ss_pred             HHhcCcHHHHHHHHHHHhcCCCceEEEECCCCCCHHHHHHHHH
Confidence            3688988877777766654333234788999999999999753


No 30 
>PRK04195 replication factor C large subunit; Provisional
Probab=96.25  E-value=0.0035  Score=52.26  Aligned_cols=43  Identities=12%  Similarity=0.216  Sum_probs=34.2

Q ss_pred             CceeecchhHHHHHHHHhcCCC---CC-cceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALND---VD-TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~---~~-~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+++|.++.++.|.+|+..-..   .. +-|+|..|+||||+|+.+.
T Consensus        14 ~dlvg~~~~~~~l~~~l~~~~~g~~~~~lLL~GppG~GKTtla~ala   60 (482)
T PRK04195         14 SDVVGNEKAKEQLREWIESWLKGKPKKALLLYGPPGVGKTSLAHALA   60 (482)
T ss_pred             HHhcCCHHHHHHHHHHHHHHhcCCCCCeEEEECCCCCCHHHHHHHHH
Confidence            4699999999999999864221   22 3788999999999999874


No 31 
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=96.25  E-value=0.0058  Score=44.74  Aligned_cols=37  Identities=14%  Similarity=-0.014  Sum_probs=24.4

Q ss_pred             hhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhhhc
Q 046733           69 GDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        69 ~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      ...+.+..++.......+-|+|..|+|||+||+.+++
T Consensus        24 ~~~~~l~~~~~~~~~~~lll~G~~G~GKT~la~~~~~   60 (226)
T TIGR03420        24 ELLAALRQLAAGKGDRFLYLWGESGSGKSHLLQAACA   60 (226)
T ss_pred             HHHHHHHHHHhcCCCCeEEEECCCCCCHHHHHHHHHH
Confidence            3455555554322222347889999999999998753


No 32 
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed
Probab=96.25  E-value=0.004  Score=55.09  Aligned_cols=43  Identities=19%  Similarity=0.097  Sum_probs=29.3

Q ss_pred             ceeecchhHH---HHHHHHhcCCCCCcceEecCCCcHHHHHHhhhc
Q 046733           63 FAYGRDGDRN---KIINRLSALNDVDTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        63 ~vvGrd~~~~---~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      +++|.+.-+.   .+...+.......+-++|..|+||||||+.+.+
T Consensus        29 d~vGQe~ii~~~~~L~~~i~~~~~~slLL~GPpGtGKTTLA~aIA~   74 (725)
T PRK13341         29 EFVGQDHILGEGRLLRRAIKADRVGSLILYGPPGVGKTTLARIIAN   74 (725)
T ss_pred             HhcCcHHHhhhhHHHHHHHhcCCCceEEEECCCCCCHHHHHHHHHH
Confidence            5888886654   344444333222347889999999999998753


No 33 
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase. It is a homohexamer. Each monomer consists of an N-terminal domain of the OB fold, which is responsible for binding to cysteine rich nucleotides. This alignment is of the C-terminal ATP binding domain.
Probab=96.22  E-value=0.0025  Score=49.52  Aligned_cols=20  Identities=25%  Similarity=0.219  Sum_probs=18.5

Q ss_pred             cceEecCCCcHHHHHHhhhc
Q 046733           86 TVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      +.|+|.+|+|||||++.+|+
T Consensus        19 ~~I~G~~G~GKTTLlr~I~n   38 (249)
T cd01128          19 GLIVAPPKAGKTTLLQSIAN   38 (249)
T ss_pred             EEEECCCCCCHHHHHHHHHh
Confidence            49999999999999999985


No 34 
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]
Probab=96.22  E-value=0.004  Score=52.37  Aligned_cols=39  Identities=18%  Similarity=0.210  Sum_probs=25.7

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.+...+++++   .....+.-.||..|+||||||+.+
T Consensus        30 ~HLlg~~~~lrr~v~---~~~l~SmIl~GPPG~GKTTlA~li   68 (436)
T COG2256          30 EHLLGEGKPLRRAVE---AGHLHSMILWGPPGTGKTTLARLI   68 (436)
T ss_pred             HhhhCCCchHHHHHh---cCCCceeEEECCCCCCHHHHHHHH
Confidence            445555555555554   222223377899999999999976


No 35 
>TIGR01242 26Sp45 26S proteasome subunit P45 family. Many proteins may score above the trusted cutoff because an internal
Probab=96.19  E-value=0.0049  Score=49.37  Aligned_cols=44  Identities=16%  Similarity=0.160  Sum_probs=32.9

Q ss_pred             CceeecchhHHHHHHHHhcC--C-----------CCCcceEecCCCcHHHHHHhhhc
Q 046733           62 KFAYGRDGDRNKIINRLSAL--N-----------DVDTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~--~-----------~~~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      .++.|+++.++.|.+.+...  .           ...+-++|..|+|||+||+++.+
T Consensus       122 ~di~Gl~~~~~~l~~~i~~~~~~~~~~~~~g~~~p~gvLL~GppGtGKT~lakaia~  178 (364)
T TIGR01242       122 EDIGGLEEQIREIREAVELPLKHPELFEEVGIEPPKGVLLYGPPGTGKTLLAKAVAH  178 (364)
T ss_pred             HHhCChHHHHHHHHHHHHHHhcCHHHHHhcCCCCCceEEEECCCCCCHHHHHHHHHH
Confidence            46889999999998876321  1           01137789999999999998863


No 36 
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I. This model represents one of two ATPase subunits of the trimeric magnesium chelatase responsible for insertion of magnesium ion into protoporphyrin IX. This is an essential step in the biosynthesis of both chlorophyll and bacteriochlorophyll. This subunit is found in green plants, photosynthetic algae, cyanobacteria and other photosynthetic bacteria.
Probab=96.17  E-value=0.0057  Score=49.54  Aligned_cols=42  Identities=14%  Similarity=0.180  Sum_probs=33.7

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~V  103 (106)
                      ..+||.++-+..++-.+.+.....+-|.|..|.|||||++.+
T Consensus         4 ~~ivgq~~~~~al~~~~~~~~~g~vli~G~~G~gKttl~r~~   45 (337)
T TIGR02030         4 TAIVGQDEMKLALLLNVIDPKIGGVMVMGDRGTGKSTAVRAL   45 (337)
T ss_pred             cccccHHHHHHHHHHHhcCCCCCeEEEEcCCCCCHHHHHHHH
Confidence            468999988888766666644445689999999999999986


No 37 
>PRK03992 proteasome-activating nucleotidase; Provisional
Probab=96.16  E-value=0.0054  Score=50.02  Aligned_cols=44  Identities=14%  Similarity=0.139  Sum_probs=32.2

Q ss_pred             CceeecchhHHHHHHHHhc---CC----------CCCcceEecCCCcHHHHHHhhhc
Q 046733           62 KFAYGRDGDRNKIINRLSA---LN----------DVDTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~---~~----------~~~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      .++.|+++.+++|.+.+..   ..          ...+-++|..|.|||+||+++.+
T Consensus       131 ~di~Gl~~~~~~l~~~i~~pl~~~~~~~~~g~~~p~gvLL~GppGtGKT~lAkaia~  187 (389)
T PRK03992        131 EDIGGLEEQIREVREAVELPLKKPELFEEVGIEPPKGVLLYGPPGTGKTLLAKAVAH  187 (389)
T ss_pred             HHhCCcHHHHHHHHHHHHHHhhCHHHHHhcCCCCCCceEEECCCCCChHHHHHHHHH
Confidence            3688999999998876532   10          01236789999999999998864


No 38 
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]
Probab=96.10  E-value=0.006  Score=54.66  Aligned_cols=41  Identities=29%  Similarity=0.428  Sum_probs=34.8

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKN  102 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~  102 (106)
                      .-|+||+++.++++..|++....+--.||-.|+|||+++.-
T Consensus       170 DPvIGRd~EI~r~iqIL~RR~KNNPvLiGEpGVGKTAIvEG  210 (786)
T COG0542         170 DPVIGRDEEIRRTIQILSRRTKNNPVLVGEPGVGKTAIVEG  210 (786)
T ss_pred             CCCcChHHHHHHHHHHHhccCCCCCeEecCCCCCHHHHHHH
Confidence            35999999999999999887665547789999999998864


No 39 
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional
Probab=96.10  E-value=0.006  Score=51.41  Aligned_cols=42  Identities=26%  Similarity=0.286  Sum_probs=31.8

Q ss_pred             CceeecchhHHHHHHHHhcCCCCC-cceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVD-TVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~-~~IvGmGGiGKTTLA~~V  103 (106)
                      .++||.++-+..|...+...+-.. +-++|..|+||||+|+.+
T Consensus        14 ~divGq~~i~~~L~~~i~~~~l~~~~Lf~GPpGtGKTTlA~~l   56 (472)
T PRK14962         14 SEVVGQDHVKKLIINALKKNSISHAYIFAGPRGTGKTTVARIL   56 (472)
T ss_pred             HHccCcHHHHHHHHHHHHcCCCCeEEEEECCCCCCHHHHHHHH
Confidence            469999887777777665543322 257899999999999976


No 40 
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=96.08  E-value=0.0036  Score=46.99  Aligned_cols=20  Identities=30%  Similarity=0.438  Sum_probs=17.6

Q ss_pred             cceEecCCCcHHHHHHhhhc
Q 046733           86 TVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      +.|+|..|+|||||++.++.
T Consensus        46 ~~l~G~~G~GKTtl~~~l~~   65 (269)
T TIGR03015        46 ILITGEVGAGKTTLIRNLLK   65 (269)
T ss_pred             EEEEcCCCCCHHHHHHHHHH
Confidence            38899999999999998763


No 41 
>CHL00081 chlI Mg-protoporyphyrin IX chelatase
Probab=96.08  E-value=0.004  Score=50.89  Aligned_cols=44  Identities=16%  Similarity=0.130  Sum_probs=35.8

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhhhc
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      +.+||.++-+..|+..+.++.-..+-|.|--|.||||+|+.+|.
T Consensus        17 ~~ivGq~~~k~al~~~~~~p~~~~vli~G~~GtGKs~~ar~~~~   60 (350)
T CHL00081         17 TAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRALVD   60 (350)
T ss_pred             HHHhChHHHHHHHHHhccCCCCCeEEEEcCCCCCHHHHHHHHHH
Confidence            57999998888887766665444457889999999999999875


No 42 
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau. This model represents the well-conserved first ~ 365 amino acids of the translation of the dnaX gene. The full-length product of the dnaX gene in the model bacterium E. coli is the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the exterme thermophile Thermus thermophilis.
Probab=95.98  E-value=0.0084  Score=46.82  Aligned_cols=42  Identities=14%  Similarity=0.152  Sum_probs=33.4

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.++.++.|.+++........ -++|..|+||||+|+.+
T Consensus        14 ~~iig~~~~~~~l~~~~~~~~~~~~~Ll~G~~G~GKt~~a~~l   56 (355)
T TIGR02397        14 EDVIGQEHIVQTLKNAIKNGRIAHAYLFSGPRGTGKTSIARIF   56 (355)
T ss_pred             hhccCcHHHHHHHHHHHHcCCCCeEEEEECCCCCCHHHHHHHH
Confidence            4689999999999988865443333 67899999999999765


No 43 
>TIGR02881 spore_V_K stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group.
Probab=95.97  E-value=0.0061  Score=46.62  Aligned_cols=43  Identities=19%  Similarity=0.107  Sum_probs=28.0

Q ss_pred             CceeecchhHHHHHH---HHhc------CCC---C---CcceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIIN---RLSA------LND---V---DTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~---~L~~------~~~---~---~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+++|.++-++.|.+   ++..      ...   .   ++-++|..|+||||+|+.+.
T Consensus         6 ~~~~Gl~~vk~~i~~~~~~~~~~~~~~~~g~~~~~~~~~vll~GppGtGKTtlA~~ia   63 (261)
T TIGR02881         6 SRMVGLDEVKALIKEIYAWIQINEKRKEEGLKTSKQVLHMIFKGNPGTGKTTVARILG   63 (261)
T ss_pred             HHhcChHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCcceEEEEcCCCCCHHHHHHHHH
Confidence            358898877766643   3311      000   1   12578999999999999874


No 44 
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]
Probab=95.87  E-value=0.0056  Score=54.60  Aligned_cols=42  Identities=29%  Similarity=0.417  Sum_probs=33.4

Q ss_pred             CceeecchhHHHHHHHHhcCC---C--CCc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALN---D--VDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~---~--~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .+-.|.++-+++|++.|.-..   .  ..+ ..||.+|+|||.|++.|
T Consensus       323 ~dHYGLekVKeRIlEyLAV~~l~~~~kGpILcLVGPPGVGKTSLgkSI  370 (782)
T COG0466         323 KDHYGLEKVKERILEYLAVQKLTKKLKGPILCLVGPPGVGKTSLGKSI  370 (782)
T ss_pred             ccccCchhHHHHHHHHHHHHHHhccCCCcEEEEECCCCCCchhHHHHH
Confidence            478899999999999984211   1  123 88899999999999976


No 45 
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional
Probab=95.84  E-value=0.0085  Score=51.56  Aligned_cols=43  Identities=16%  Similarity=0.236  Sum_probs=33.9

Q ss_pred             CceeecchhHHHHHHHHhcCCCCC-cceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVD-TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~-~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+++|.+..++.|...+...+... +-++|..|+||||+|+.+.
T Consensus        16 ~diiGq~~~v~~L~~~i~~~rl~ha~Lf~Gp~GvGKTTlAr~lA   59 (546)
T PRK14957         16 AEVAGQQHALNSLVHALETQKVHHAYLFTGTRGVGKTTLGRLLA   59 (546)
T ss_pred             HHhcCcHHHHHHHHHHHHcCCCCeEEEEECCCCCCHHHHHHHHH
Confidence            469999999988888886544333 2578999999999998763


No 46 
>PRK05564 DNA polymerase III subunit delta'; Validated
Probab=95.82  E-value=0.012  Score=46.17  Aligned_cols=43  Identities=28%  Similarity=0.383  Sum_probs=34.5

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+++|.+.-++.+..++...+-... -++|..|+||||||+.+.
T Consensus         4 ~~i~g~~~~~~~l~~~~~~~~~~ha~Lf~G~~G~Gk~~la~~~a   47 (313)
T PRK05564          4 HTIIGHENIKNRIKNSIIKNRFSHAHIIVGEDGIGKSLLAKEIA   47 (313)
T ss_pred             hhccCcHHHHHHHHHHHHcCCCCceEEeECCCCCCHHHHHHHHH
Confidence            4688998888999988866544444 788999999999998754


No 47 
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed
Probab=95.81  E-value=0.011  Score=44.28  Aligned_cols=18  Identities=28%  Similarity=0.243  Sum_probs=16.2

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|.|..|.|||||++.+.
T Consensus        37 gi~G~~GsGKTTl~~~L~   54 (229)
T PRK09270         37 GIAGPPGAGKSTLAEFLE   54 (229)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            899999999999999753


No 48 
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional
Probab=95.77  E-value=0.01  Score=50.48  Aligned_cols=42  Identities=17%  Similarity=0.213  Sum_probs=34.0

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .++||.+.-++.|.+++...+-... -.+|..|+||||+|+.+
T Consensus        16 ~divGq~~v~~~L~~~~~~~~l~ha~Lf~Gp~G~GKTt~A~~l   58 (509)
T PRK14958         16 QEVIGQAPVVRALSNALDQQYLHHAYLFTGTRGVGKTTISRIL   58 (509)
T ss_pred             HHhcCCHHHHHHHHHHHHhCCCCeeEEEECCCCCCHHHHHHHH
Confidence            4699999999999998866544332 67899999999999864


No 49 
>PRK13531 regulatory ATPase RavA; Provisional
Probab=95.76  E-value=0.0088  Score=51.20  Aligned_cols=41  Identities=15%  Similarity=0.160  Sum_probs=32.4

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      ..++|+++.++.++.-+....  ++-|.|..|+|||+||+.+.
T Consensus        20 ~~i~gre~vI~lll~aalag~--hVLL~GpPGTGKT~LAraLa   60 (498)
T PRK13531         20 KGLYERSHAIRLCLLAALSGE--SVFLLGPPGIAKSLIARRLK   60 (498)
T ss_pred             hhccCcHHHHHHHHHHHccCC--CEEEECCCChhHHHHHHHHH
Confidence            578999988888877665432  34888999999999999764


No 50 
>PHA00729 NTP-binding motif containing protein
Probab=95.75  E-value=0.0091  Score=46.27  Aligned_cols=31  Identities=29%  Similarity=0.328  Sum_probs=22.0

Q ss_pred             HHHHHHhcCCCCCcceEecCCCcHHHHHHhh
Q 046733           73 KIINRLSALNDVDTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        73 ~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~V  103 (106)
                      ++++.+......++-|.|..|+||||||..+
T Consensus         7 ~~~~~l~~~~f~nIlItG~pGvGKT~LA~aL   37 (226)
T PHA00729          7 KIVSAYNNNGFVSAVIFGKQGSGKTTYALKV   37 (226)
T ss_pred             HHHHHHhcCCeEEEEEECCCCCCHHHHHHHH
Confidence            3444444433334588999999999999986


No 51 
>TIGR02902 spore_lonB ATP-dependent protease LonB. Members of this protein are LonB, a paralog of the ATP-dependent protease La (LonA, TIGR00763). LonB proteins are found strictly, and almost universally, in endospore-forming bacteria. This protease was shown, in Bacillus subtilis, to be expressed specifically in the forespore, during sporulation, under control of sigma(F). The lonB gene, despite location immediately upstream of lonA, was shown to be monocistronic. LonB appears able to act on sigma(H) for post-translation control, but lonB mutation did not produce an obvious sporulation defect under the conditions tested. Note that additional paralogs of LonA and LonB occur in the Clostridium lineage and this model selects only one per species as the protein that corresponds to LonB in B. subtilis.
Probab=95.74  E-value=0.011  Score=50.35  Aligned_cols=43  Identities=19%  Similarity=0.218  Sum_probs=34.4

Q ss_pred             ceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhhhc
Q 046733           63 FAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        63 ~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      +++|.+...+.+...+.......+-|+|..|+|||++|+.+++
T Consensus        66 ~iiGqs~~i~~l~~al~~~~~~~vLi~Ge~GtGKt~lAr~i~~  108 (531)
T TIGR02902        66 EIIGQEEGIKALKAALCGPNPQHVIIYGPPGVGKTAAARLVLE  108 (531)
T ss_pred             HeeCcHHHHHHHHHHHhCCCCceEEEECCCCCCHHHHHHHHHH
Confidence            6999998888888776544333457889999999999999863


No 52 
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional
Probab=95.70  E-value=0.012  Score=48.09  Aligned_cols=42  Identities=17%  Similarity=0.131  Sum_probs=32.2

Q ss_pred             CceeecchhHHHHHHHHhcCCCCC-cceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVD-TVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~-~~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.+.-++.|..++...+... +-++|..|+||||+|..+
T Consensus        16 ~eiiGq~~~~~~L~~~~~~~~~~ha~lf~Gp~G~GKtt~A~~~   58 (397)
T PRK14955         16 ADITAQEHITRTIQNSLRMGRVGHGYIFSGLRGVGKTTAARVF   58 (397)
T ss_pred             hhccChHHHHHHHHHHHHhCCcceeEEEECCCCCCHHHHHHHH
Confidence            468999888888888776544332 367899999999999864


No 53 
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional
Probab=95.68  E-value=0.01  Score=50.55  Aligned_cols=42  Identities=17%  Similarity=0.156  Sum_probs=33.9

Q ss_pred             CceeecchhHHHHHHHHhcCCCCC-cceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVD-TVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~-~~IvGmGGiGKTTLA~~V  103 (106)
                      .++||.+.-+..|..++...+... +-++|..|+||||+|+.+
T Consensus        18 ~dvVGQe~iv~~L~~~i~~~ri~ha~Lf~GP~GtGKTTlAriL   60 (484)
T PRK14956         18 RDVIHQDLAIGALQNALKSGKIGHAYIFFGPRGVGKTTIARIL   60 (484)
T ss_pred             HHHhChHHHHHHHHHHHHcCCCCeEEEEECCCCCCHHHHHHHH
Confidence            469999998888888887655333 378899999999999976


No 54 
>PRK15455 PrkA family serine protein kinase; Provisional
Probab=95.64  E-value=0.012  Score=51.74  Aligned_cols=42  Identities=17%  Similarity=0.241  Sum_probs=33.3

Q ss_pred             ceeecchhHHHHHHHHhcC----CCC-Cc-ceEecCCCcHHHHHHhhh
Q 046733           63 FAYGRDGDRNKIINRLSAL----NDV-DT-VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        63 ~vvGrd~~~~~lv~~L~~~----~~~-~~-~IvGmGGiGKTTLA~~Vy  104 (106)
                      +++|.++.+++|++.|...    ... .+ -++|..|.||||||+.+-
T Consensus        77 d~yGlee~ieriv~~l~~Aa~gl~~~~~IL~LvGPpG~GKSsLa~~la  124 (644)
T PRK15455         77 EFYGMEEAIEQIVSYFRHAAQGLEEKKQILYLLGPVGGGKSSLAERLK  124 (644)
T ss_pred             cccCcHHHHHHHHHHHHHHHHhcCCCCceEEEecCCCCCchHHHHHHH
Confidence            5899999999999998321    111 34 888999999999999863


No 55 
>PRK06547 hypothetical protein; Provisional
Probab=95.64  E-value=0.013  Score=42.94  Aligned_cols=17  Identities=29%  Similarity=0.409  Sum_probs=15.7

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .|.|..|.||||||+.+
T Consensus        19 ~i~G~~GsGKTt~a~~l   35 (172)
T PRK06547         19 LIDGRSGSGKTTLAGAL   35 (172)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            88899999999999976


No 56 
>PRK09376 rho transcription termination factor Rho; Provisional
Probab=95.61  E-value=0.0062  Score=51.11  Aligned_cols=19  Identities=37%  Similarity=0.359  Sum_probs=17.9

Q ss_pred             ceEecCCCcHHHHHHhhhc
Q 046733           87 VIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy~  105 (106)
                      -|+|.+|+||||||+.||+
T Consensus       173 lIvgppGvGKTTLaK~Ian  191 (416)
T PRK09376        173 LIVAPPKAGKTVLLQNIAN  191 (416)
T ss_pred             EEeCCCCCChhHHHHHHHH
Confidence            8999999999999999985


No 57 
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional
Probab=95.55  E-value=0.014  Score=49.64  Aligned_cols=43  Identities=16%  Similarity=0.174  Sum_probs=33.1

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+++|.++-++.|.+++....-... -++|..|+||||+|+.+.
T Consensus        14 ~dvvGq~~v~~~L~~~i~~~~l~ha~Lf~GppGtGKTTlA~~lA   57 (504)
T PRK14963         14 DEVVGQEHVKEVLLAALRQGRLGHAYLFSGPRGVGKTTTARLIA   57 (504)
T ss_pred             HHhcChHHHHHHHHHHHHcCCCCeEEEEECCCCCCHHHHHHHHH
Confidence            3689999888888887765443233 678999999999998763


No 58 
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional
Probab=95.55  E-value=0.014  Score=51.73  Aligned_cols=42  Identities=14%  Similarity=0.190  Sum_probs=34.0

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .++||.+.-++.|.+++...+.... -+.|..|+||||+|+.+
T Consensus        15 ddVIGQe~vv~~L~~aI~~grl~HAyLF~GPpGvGKTTlAriL   57 (702)
T PRK14960         15 NELVGQNHVSRALSSALERGRLHHAYLFTGTRGVGKTTIARIL   57 (702)
T ss_pred             HHhcCcHHHHHHHHHHHHcCCCCeEEEEECCCCCCHHHHHHHH
Confidence            4699999999999998876543333 67899999999999864


No 59 
>PRK05896 DNA polymerase III subunits gamma and tau; Validated
Probab=95.51  E-value=0.014  Score=50.90  Aligned_cols=42  Identities=19%  Similarity=0.236  Sum_probs=33.2

Q ss_pred             CceeecchhHHHHHHHHhcCCCCC-cceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVD-TVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~-~~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.+.-++.+.+.+...+... +-+.|..|+||||+|+.+
T Consensus        16 ~dIIGQe~iv~~L~~aI~~~rl~hA~Lf~GP~GvGKTTlA~~l   58 (605)
T PRK05896         16 KQIIGQELIKKILVNAILNNKLTHAYIFSGPRGIGKTSIAKIF   58 (605)
T ss_pred             HHhcCcHHHHHHHHHHHHcCCCCceEEEECCCCCCHHHHHHHH
Confidence            469999998888888876544333 367899999999999875


No 60 
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional
Probab=95.50  E-value=0.013  Score=49.82  Aligned_cols=42  Identities=17%  Similarity=0.222  Sum_probs=33.5

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.+.-++.|.+++...+-... -+.|..|+||||+|+.+
T Consensus        16 ~divGq~~v~~~L~~~i~~~~~~ha~Lf~Gp~G~GKTt~A~~l   58 (527)
T PRK14969         16 SELVGQEHVVRALTNALEQQRLHHAYLFTGTRGVGKTTLARIL   58 (527)
T ss_pred             HHhcCcHHHHHHHHHHHHcCCCCEEEEEECCCCCCHHHHHHHH
Confidence            4689999989988888866544332 68899999999999875


No 61 
>PRK13407 bchI magnesium chelatase subunit I; Provisional
Probab=95.47  E-value=0.015  Score=47.20  Aligned_cols=42  Identities=12%  Similarity=0.152  Sum_probs=31.5

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~V  103 (106)
                      ..++|.++.++.+.-.+.......+-+.|..|.||||||+.+
T Consensus         8 ~~i~Gq~~~~~~l~~~~~~~~~~~vLl~G~pG~gKT~lar~l   49 (334)
T PRK13407          8 SAIVGQEEMKQAMVLTAIDPGIGGVLVFGDRGTGKSTAVRAL   49 (334)
T ss_pred             HHhCCHHHHHHHHHHHHhccCCCcEEEEcCCCCCHHHHHHHH
Confidence            578999988887764444333334578899999999999975


No 62 
>PRK08903 DnaA regulatory inactivator Hda; Validated
Probab=95.40  E-value=0.027  Score=41.74  Aligned_cols=20  Identities=15%  Similarity=0.197  Sum_probs=17.5

Q ss_pred             cceEecCCCcHHHHHHhhhc
Q 046733           86 TVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      +-|+|..|+|||+||+.+++
T Consensus        45 ~~l~G~~G~GKT~La~ai~~   64 (227)
T PRK08903         45 FYLWGEAGSGRSHLLQALVA   64 (227)
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            37889999999999998763


No 63 
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional
Probab=95.40  E-value=0.016  Score=50.64  Aligned_cols=42  Identities=19%  Similarity=0.254  Sum_probs=33.5

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .++||.+.-++.|.+++...+.... -++|.-|+||||+|+.+
T Consensus        16 ~dviGQe~vv~~L~~~l~~~rl~ha~Lf~Gp~GvGKTtlAr~l   58 (618)
T PRK14951         16 SEMVGQEHVVQALTNALTQQRLHHAYLFTGTRGVGKTTVSRIL   58 (618)
T ss_pred             HHhcCcHHHHHHHHHHHHcCCCCeEEEEECCCCCCHHHHHHHH
Confidence            4689988888888888876554333 67899999999999875


No 64 
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional
Probab=95.38  E-value=0.016  Score=51.37  Aligned_cols=42  Identities=14%  Similarity=0.217  Sum_probs=34.2

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .++||.++-++.|.+.+...+-... -++|..|+||||+|+.+
T Consensus        16 ddVIGQe~vv~~L~~al~~gRLpHA~LFtGP~GvGKTTLAriL   58 (700)
T PRK12323         16 TTLVGQEHVVRALTHALEQQRLHHAYLFTGTRGVGKTTLSRIL   58 (700)
T ss_pred             HHHcCcHHHHHHHHHHHHhCCCceEEEEECCCCCCHHHHHHHH
Confidence            4699999999999988876554433 67899999999999875


No 65 
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]
Probab=95.37  E-value=0.012  Score=48.03  Aligned_cols=42  Identities=21%  Similarity=0.313  Sum_probs=29.8

Q ss_pred             CceeecchhHHHHHHHHhcC---CCC-C-cceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSAL---NDV-D-TVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~---~~~-~-~~IvGmGGiGKTTLA~~V  103 (106)
                      .+.||.++-++.+-=.+...   ... + +-+.|..|+||||||..|
T Consensus        26 ~efiGQ~~vk~~L~ifI~AAk~r~e~lDHvLl~GPPGlGKTTLA~II   72 (332)
T COG2255          26 DEFIGQEKVKEQLQIFIKAAKKRGEALDHVLLFGPPGLGKTTLAHII   72 (332)
T ss_pred             HHhcChHHHHHHHHHHHHHHHhcCCCcCeEEeeCCCCCcHHHHHHHH
Confidence            46899888777765555322   111 2 378899999999999876


No 66 
>PRK08691 DNA polymerase III subunits gamma and tau; Validated
Probab=95.31  E-value=0.018  Score=51.24  Aligned_cols=42  Identities=17%  Similarity=0.193  Sum_probs=34.1

Q ss_pred             CceeecchhHHHHHHHHhcCCCCC-cceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVD-TVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~-~~IvGmGGiGKTTLA~~V  103 (106)
                      .++||.+.-++.|.+++...+... +-++|..|+||||+|+.+
T Consensus        16 ddIIGQe~vv~~L~~ai~~~rl~Ha~Lf~GP~GvGKTTlAriL   58 (709)
T PRK08691         16 ADLVGQEHVVKALQNALDEGRLHHAYLLTGTRGVGKTTIARIL   58 (709)
T ss_pred             HHHcCcHHHHHHHHHHHHcCCCCeEEEEECCCCCcHHHHHHHH
Confidence            469999999999999887654332 377899999999999865


No 67 
>PF00158 Sigma54_activat:  Sigma-54 interaction domain;  InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor. These have a conserved domain of about 230 residues involved in the ATP-dependent [, ] interaction with sigma-54. About half of the proteins in which this domain is found (algB, dcdT, flbD, hoxA, hupR1, hydG, ntrC, pgtA and pilR) belong to signal transduction two-component systems [] and possess a domain that can be phosphorylated by a sensor-kinase protein in their N-terminal section. Almost all of these proteins possess a helix-turn-helix DNA-binding domain in their C-terminal section. The domain which interacts with the sigma-54 factor has an ATPase activity. This may be required to promote a conformational change necessary for the interaction []. The domain contains an atypical ATP-binding motif A (P-loop) as well as a form of motif B. The two ATP-binding motifs are located in the N-terminal section of the domain.; GO: 0005524 ATP binding, 0008134 transcription factor binding, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 1NY6_K 3M0E_G 1NY5_A 1OJL_A 3DZD_B 2C9C_A 2C98_A 2C96_A 2BJV_A 2C99_A ....
Probab=95.28  E-value=0.021  Score=41.62  Aligned_cols=42  Identities=17%  Similarity=0.226  Sum_probs=30.8

Q ss_pred             eeecchhHHHHHHHHhcCCC--CCcceEecCCCcHHHHHHhhhc
Q 046733           64 AYGRDGDRNKIINRLSALND--VDTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        64 vvGrd~~~~~lv~~L~~~~~--~~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      +||......++++.+..-..  ..+-|+|-.|.||+.+|+.++.
T Consensus         1 liG~s~~m~~~~~~~~~~a~~~~pVlI~GE~GtGK~~lA~~IH~   44 (168)
T PF00158_consen    1 LIGESPAMKRLREQAKRAASSDLPVLITGETGTGKELLARAIHN   44 (168)
T ss_dssp             SS--SHHHHHHHHHHHHHTTSTS-EEEECSTTSSHHHHHHHHHH
T ss_pred             CEeCCHHHHHHHHHHHHHhCCCCCEEEEcCCCCcHHHHHHHHHH
Confidence            47888888888887754333  2348889999999999999985


No 68 
>PRK09111 DNA polymerase III subunits gamma and tau; Validated
Probab=95.26  E-value=0.021  Score=49.61  Aligned_cols=42  Identities=14%  Similarity=0.237  Sum_probs=34.0

Q ss_pred             CceeecchhHHHHHHHHhcCCCCC-cceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVD-TVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~-~~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.+..++.|.+.+...+-.. +-+.|.-|+||||+|+.+
T Consensus        24 ~dliGq~~~v~~L~~~~~~gri~ha~L~~Gp~GvGKTt~Ar~l   66 (598)
T PRK09111         24 DDLIGQEAMVRTLTNAFETGRIAQAFMLTGVRGVGKTTTARIL   66 (598)
T ss_pred             HHhcCcHHHHHHHHHHHHcCCCCceEEEECCCCCCHHHHHHHH
Confidence            469999999999998886654333 377899999999999875


No 69 
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional
Probab=95.26  E-value=0.022  Score=45.38  Aligned_cols=42  Identities=17%  Similarity=0.240  Sum_probs=33.3

Q ss_pred             CceeecchhHHHHHHHHhcCCCCC-cceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVD-TVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~-~~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.+..++.+.+.+....... +-++|..|+||||+|+.+
T Consensus        17 ~~iig~~~~~~~l~~~i~~~~~~~~~L~~G~~G~GKt~~a~~l   59 (367)
T PRK14970         17 DDVVGQSHITNTLLNAIENNHLAQALLFCGPRGVGKTTCARIL   59 (367)
T ss_pred             HhcCCcHHHHHHHHHHHHcCCCCeEEEEECCCCCCHHHHHHHH
Confidence            468999999998888886543332 368899999999999865


No 70 
>PRK08084 DNA replication initiation factor; Provisional
Probab=95.18  E-value=0.03  Score=42.44  Aligned_cols=20  Identities=10%  Similarity=0.054  Sum_probs=17.4

Q ss_pred             cceEecCCCcHHHHHHhhhc
Q 046733           86 TVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      +-|+|..|+|||+|++.+.+
T Consensus        48 l~l~Gp~G~GKThLl~a~~~   67 (235)
T PRK08084         48 IYLWSREGAGRSHLLHAACA   67 (235)
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            38999999999999998653


No 71 
>PRK03846 adenylylsulfate kinase; Provisional
Probab=95.17  E-value=0.013  Score=43.01  Aligned_cols=18  Identities=28%  Similarity=0.357  Sum_probs=16.3

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|+.|.||||||+.+-
T Consensus        28 ~i~G~~GsGKSTla~~l~   45 (198)
T PRK03846         28 WFTGLSGSGKSTVAGALE   45 (198)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            899999999999999763


No 72 
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional
Probab=95.15  E-value=0.021  Score=52.10  Aligned_cols=43  Identities=16%  Similarity=0.197  Sum_probs=34.2

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~Vy  104 (106)
                      .++||.+.-++.|.+.+...+-... -++|..|+||||+|+.+.
T Consensus        16 ddIIGQe~Iv~~LknaI~~~rl~HAyLFtGPpGtGKTTLARiLA   59 (944)
T PRK14949         16 EQMVGQSHVLHALTNALTQQRLHHAYLFTGTRGVGKTSLARLFA   59 (944)
T ss_pred             HHhcCcHHHHHHHHHHHHhCCCCeEEEEECCCCCCHHHHHHHHH
Confidence            4699999999988888866543333 588999999999999764


No 73 
>PRK07994 DNA polymerase III subunits gamma and tau; Validated
Probab=95.14  E-value=0.021  Score=50.20  Aligned_cols=42  Identities=17%  Similarity=0.199  Sum_probs=33.4

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .++||.+.-++.|.+.+...+-... -++|.-|+||||+|+.+
T Consensus        16 ~divGQe~vv~~L~~~l~~~rl~hAyLf~Gp~GvGKTTlAr~l   58 (647)
T PRK07994         16 AEVVGQEHVLTALANALDLGRLHHAYLFSGTRGVGKTTIARLL   58 (647)
T ss_pred             HHhcCcHHHHHHHHHHHHcCCCCeEEEEECCCCCCHHHHHHHH
Confidence            4699999988888888866544332 57899999999999875


No 74 
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional
Probab=95.12  E-value=0.022  Score=48.94  Aligned_cols=42  Identities=14%  Similarity=0.175  Sum_probs=33.0

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.+.-++.|.+++........ -++|..|+||||+|+.+
T Consensus        16 ~eiiGq~~~~~~L~~~i~~~~i~~a~Lf~Gp~G~GKTtlA~~l   58 (585)
T PRK14950         16 AELVGQEHVVQTLRNAIAEGRVAHAYLFTGPRGVGKTSTARIL   58 (585)
T ss_pred             HHhcCCHHHHHHHHHHHHhCCCceEEEEECCCCCCHHHHHHHH
Confidence            4699999988888888765443222 57899999999999875


No 75 
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional
Probab=95.11  E-value=0.025  Score=48.24  Aligned_cols=42  Identities=24%  Similarity=0.229  Sum_probs=32.1

Q ss_pred             CceeecchhHHHHHHHHhcCCCCC-cceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVD-TVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~-~~IvGmGGiGKTTLA~~V  103 (106)
                      .++||.+.-++.|.+.+...+-.. +-+.|..|+||||+|+.+
T Consensus        13 ~dliGQe~vv~~L~~a~~~~ri~ha~Lf~Gp~G~GKTT~Aril   55 (491)
T PRK14964         13 KDLVGQDVLVRILRNAFTLNKIPQSILLVGASGVGKTTCARII   55 (491)
T ss_pred             HHhcCcHHHHHHHHHHHHcCCCCceEEEECCCCccHHHHHHHH
Confidence            469999988888777775544332 367899999999999864


No 76 
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=95.01  E-value=0.027  Score=39.01  Aligned_cols=19  Identities=26%  Similarity=0.559  Sum_probs=17.1

Q ss_pred             cceEecCCCcHHHHHHhhh
Q 046733           86 TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +.|+|..|+|||||.+.+.
T Consensus        17 v~i~G~~g~GKStLl~~l~   35 (173)
T cd04155          17 ILILGLDNAGKTTILKQLA   35 (173)
T ss_pred             EEEEccCCCCHHHHHHHHh
Confidence            4999999999999999875


No 77 
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional
Probab=94.98  E-value=0.025  Score=49.09  Aligned_cols=42  Identities=17%  Similarity=0.134  Sum_probs=33.6

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .++||.+.-++.|.+++...+-... -+.|.-|+||||+|+.+
T Consensus        13 ~eivGq~~i~~~L~~~i~~~r~~ha~Lf~Gp~G~GKTt~A~~l   55 (584)
T PRK14952         13 AEVVGQEHVTEPLSSALDAGRINHAYLFSGPRGCGKTSSARIL   55 (584)
T ss_pred             HHhcCcHHHHHHHHHHHHcCCCCeEEEEECCCCCCHHHHHHHH
Confidence            4699999989999888876543332 57899999999999864


No 78 
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]
Probab=94.93  E-value=0.026  Score=47.90  Aligned_cols=17  Identities=29%  Similarity=0.434  Sum_probs=15.8

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      -.||..|.||||||+.+
T Consensus       166 IlWGppG~GKTtlArli  182 (554)
T KOG2028|consen  166 ILWGPPGTGKTTLARLI  182 (554)
T ss_pred             EEecCCCCchHHHHHHH
Confidence            78999999999999976


No 79 
>PRK06645 DNA polymerase III subunits gamma and tau; Validated
Probab=94.90  E-value=0.03  Score=47.77  Aligned_cols=43  Identities=16%  Similarity=0.101  Sum_probs=33.1

Q ss_pred             CceeecchhHHHHHHHHhcCCCC-CcceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDV-DTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~-~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+++|.+.-++.|.+.+...+-. .+-+.|..|+||||+|+.+.
T Consensus        21 ~dliGq~~vv~~L~~ai~~~ri~~a~Lf~Gp~G~GKTT~ArilA   64 (507)
T PRK06645         21 AELQGQEVLVKVLSYTILNDRLAGGYLLTGIRGVGKTTSARIIA   64 (507)
T ss_pred             HHhcCcHHHHHHHHHHHHcCCCCceEEEECCCCCCHHHHHHHHH
Confidence            36899999888887766554432 23678999999999999864


No 80 
>PRK06893 DNA replication initiation factor; Validated
Probab=94.89  E-value=0.016  Score=43.66  Aligned_cols=19  Identities=26%  Similarity=0.129  Sum_probs=17.0

Q ss_pred             ceEecCCCcHHHHHHhhhc
Q 046733           87 VIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy~  105 (106)
                      -++|..|+|||+|++++.+
T Consensus        43 ~l~G~~G~GKThL~~ai~~   61 (229)
T PRK06893         43 YIWGGKSSGKSHLLKAVSN   61 (229)
T ss_pred             EEECCCCCCHHHHHHHHHH
Confidence            6889999999999998753


No 81 
>PRK06620 hypothetical protein; Validated
Probab=94.87  E-value=0.018  Score=43.38  Aligned_cols=18  Identities=28%  Similarity=0.189  Sum_probs=16.4

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      -|+|..|+|||+|++.+.
T Consensus        48 ~l~Gp~G~GKThLl~a~~   65 (214)
T PRK06620         48 LIKGPSSSGKTYLTKIWQ   65 (214)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            889999999999999864


No 82 
>PRK07003 DNA polymerase III subunits gamma and tau; Validated
Probab=94.86  E-value=0.028  Score=50.68  Aligned_cols=42  Identities=14%  Similarity=0.180  Sum_probs=33.5

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .++||.++-++.|.+++...+.... -++|.-|+||||+|+.+
T Consensus        16 dEVIGQe~Vv~~L~~aL~~gRL~HAyLFtGPpGvGKTTlAriL   58 (830)
T PRK07003         16 ASLVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIF   58 (830)
T ss_pred             HHHcCcHHHHHHHHHHHhcCCCCeEEEEECCCCCCHHHHHHHH
Confidence            4699999999999988866543333 67899999999999854


No 83 
>COG0714 MoxR-like ATPases [General function prediction only]
Probab=94.86  E-value=0.036  Score=43.77  Aligned_cols=40  Identities=20%  Similarity=0.260  Sum_probs=29.1

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~V  103 (106)
                      ..++|.++....+...+.....  +-+.|..|+|||+||+.+
T Consensus        24 ~~~~g~~~~~~~~l~a~~~~~~--vll~G~PG~gKT~la~~l   63 (329)
T COG0714          24 KVVVGDEEVIELALLALLAGGH--VLLEGPPGVGKTLLARAL   63 (329)
T ss_pred             CeeeccHHHHHHHHHHHHcCCC--EEEECCCCccHHHHHHHH
Confidence            4588877777766555544322  378899999999999975


No 84 
>PF01078 Mg_chelatase:  Magnesium chelatase, subunit ChlI;  InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. As a result, it is thought that Mg-chelatase has an important role in channeling intermediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weights between 38-42 kDa.; GO: 0016851 magnesium chelatase activity, 0015979 photosynthesis, 0015995 chlorophyll biosynthetic process; PDB: 2X31_J 1G8P_A 3K1J_B.
Probab=94.85  E-value=0.032  Score=42.76  Aligned_cols=40  Identities=13%  Similarity=0.256  Sum_probs=28.7

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~V  103 (106)
                      ++|+|.+..++.|.--...  .+++-++|..|+|||+||+.+
T Consensus         3 ~dI~GQe~aKrAL~iAAaG--~h~lLl~GppGtGKTmlA~~l   42 (206)
T PF01078_consen    3 SDIVGQEEAKRALEIAAAG--GHHLLLIGPPGTGKTMLARRL   42 (206)
T ss_dssp             CCSSSTHHHHHHHHHHHHC--C--EEEES-CCCTHHHHHHHH
T ss_pred             hhhcCcHHHHHHHHHHHcC--CCCeEEECCCCCCHHHHHHHH
Confidence            5789998877776543333  345689999999999999975


No 85 
>PRK07764 DNA polymerase III subunits gamma and tau; Validated
Probab=94.83  E-value=0.031  Score=50.25  Aligned_cols=42  Identities=14%  Similarity=0.104  Sum_probs=33.7

Q ss_pred             CceeecchhHHHHHHHHhcCCCCC-cceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVD-TVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~-~~IvGmGGiGKTTLA~~V  103 (106)
                      .+|||.+..++.|...|...+... +-+.|.-|+||||+|+.+
T Consensus        15 ~eiiGqe~v~~~L~~~i~~~ri~Ha~Lf~Gp~G~GKTt~A~~l   57 (824)
T PRK07764         15 AEVIGQEHVTEPLSTALDSGRINHAYLFSGPRGCGKTSSARIL   57 (824)
T ss_pred             HHhcCcHHHHHHHHHHHHhCCCCceEEEECCCCCCHHHHHHHH
Confidence            469999998888888887654433 367899999999999865


No 86 
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional
Probab=94.71  E-value=0.036  Score=48.42  Aligned_cols=42  Identities=17%  Similarity=0.141  Sum_probs=32.1

Q ss_pred             CceeecchhHHHHHHHHhcCCCCC-cceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVD-TVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~-~~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.+.-+..|.+.+...+... +-++|..|+||||+|..+
T Consensus        16 ~eivGQe~i~~~L~~~i~~~ri~ha~Lf~Gp~GvGKttlA~~l   58 (620)
T PRK14954         16 ADITAQEHITHTIQNSLRMDRVGHGYIFSGLRGVGKTTAARVF   58 (620)
T ss_pred             HHhcCcHHHHHHHHHHHHcCCCCeeEEEECCCCCCHHHHHHHH
Confidence            468999988888887775544333 367899999999999753


No 87 
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX. Proteins in this family are now designated CbbX. Some previously were CfxQ (carbon fixation Q). Its gene is often found immmediately downstream of the Rubisco large and small chain genes, and it is suggested to be necessary for Rubisco expression. CbbX has been shown to be necessary for photoautotrophic growth. This protein belongs to the larger family of pfam00004, ATPase family Associated with various cellular Activities. Within that larger family, members of this family are most closely related to the stage V sporulation protein K, or SpoVK, in endospore-forming bacteria such as Bacillus subtilis.
Probab=94.68  E-value=0.042  Score=43.05  Aligned_cols=41  Identities=17%  Similarity=0.109  Sum_probs=27.0

Q ss_pred             ceeecchhHHHHHHHHh---cC------C-C---C--CcceEecCCCcHHHHHHhh
Q 046733           63 FAYGRDGDRNKIINRLS---AL------N-D---V--DTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        63 ~vvGrd~~~~~lv~~L~---~~------~-~---~--~~~IvGmGGiGKTTLA~~V  103 (106)
                      .++|.++-++.|.++..   ..      . .   .  .+-++|..|.||||+|+.+
T Consensus        23 ~l~Gl~~vk~~i~e~~~~~~~~~~r~~~g~~~~~~~~~vll~G~pGTGKT~lA~~i   78 (284)
T TIGR02880        23 ELIGLKPVKTRIREIAALLLVERLRQRLGLASAAPTLHMSFTGNPGTGKTTVALRM   78 (284)
T ss_pred             hccCHHHHHHHHHHHHHHHHHHHHHHHhCCCcCCCCceEEEEcCCCCCHHHHHHHH
Confidence            68999877777655321   10      0 0   1  1257799999999999654


No 88 
>CHL00181 cbbX CbbX; Provisional
Probab=94.67  E-value=0.037  Score=43.61  Aligned_cols=43  Identities=19%  Similarity=0.101  Sum_probs=28.1

Q ss_pred             CceeecchhHHHHHHH---HhcC------C---C-CC--cceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINR---LSAL------N---D-VD--TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~---L~~~------~---~-~~--~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+++|.++-++.|.++   +.-.      .   . ..  +-+.|..|.||||+|+.+.
T Consensus        23 ~~l~Gl~~vK~~i~e~~~~~~~~~~~~~~g~~~~~~~~~ill~G~pGtGKT~lAr~la   80 (287)
T CHL00181         23 EELVGLAPVKTRIREIAALLLIDRLRKNLGLTSSNPGLHMSFTGSPGTGKTTVALKMA   80 (287)
T ss_pred             HhcCCcHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCCceEEEECCCCCCHHHHHHHHH
Confidence            3689998777755443   2111      0   0 11  2567999999999999874


No 89 
>PRK08727 hypothetical protein; Validated
Probab=94.63  E-value=0.046  Score=41.38  Aligned_cols=20  Identities=20%  Similarity=0.184  Sum_probs=17.5

Q ss_pred             cceEecCCCcHHHHHHhhhc
Q 046733           86 TVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      +-|+|..|+|||.|++++++
T Consensus        44 l~l~G~~G~GKThL~~a~~~   63 (233)
T PRK08727         44 LYLSGPAGTGKTHLALALCA   63 (233)
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            38899999999999998753


No 90 
>cd00879 Sar1 Sar1 subfamily.  Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER.  The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER.  Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12.  Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification.  Instead, Sar1 contains a unique nine-amino-acid N-terminal extension.  This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif.  The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.
Probab=94.57  E-value=0.044  Score=38.83  Aligned_cols=20  Identities=15%  Similarity=0.378  Sum_probs=17.3

Q ss_pred             CcceEecCCCcHHHHHHhhh
Q 046733           85 DTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        85 ~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+.|+|.+|+|||||...+.
T Consensus        21 ki~ilG~~~~GKStLi~~l~   40 (190)
T cd00879          21 KILFLGLDNAGKTTLLHMLK   40 (190)
T ss_pred             EEEEECCCCCCHHHHHHHHh
Confidence            34999999999999998764


No 91 
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily.  Arl5 (Arf-like 5) and Arl8, like Arl4 and Arl7, are localized to the nucleus and nucleolus.  Arl5 is developmentally regulated during embryogenesis in mice.  Human Arl5 interacts with the heterochromatin protein 1-alpha (HP1alpha), a nonhistone chromosomal protein that is associated with heterochromatin and telomeres, and prevents telomere fusion.  Arl5 may also play a role in embryonic nuclear dynamics and/or signaling cascades. Arl8 was identified from a fetal cartilage cDNA library.  It is found in brain, heart, lung, cartilage, and kidney.  No function has been assigned for Arl8 to date.
Probab=94.54  E-value=0.045  Score=38.69  Aligned_cols=33  Identities=15%  Similarity=0.318  Sum_probs=22.1

Q ss_pred             HHHHHHHhcCCCCCcceEecCCCcHHHHHHhhh
Q 046733           72 NKIINRLSALNDVDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        72 ~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +.+.+++......++.++|..|+|||||...+.
T Consensus         4 ~~~~~~~~~~~~~kv~~~G~~~~GKTsl~~~l~   36 (174)
T cd04153           4 SSLWSLFFPRKEYKVIIVGLDNAGKTTILYQFL   36 (174)
T ss_pred             hHHHHHhcCCCccEEEEECCCCCCHHHHHHHHc
Confidence            344554433222345899999999999998764


No 92 
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH. HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH.
Probab=94.53  E-value=0.041  Score=46.02  Aligned_cols=43  Identities=21%  Similarity=0.329  Sum_probs=29.0

Q ss_pred             CceeecchhHHHHHHHH---hcCC-----CC----CcceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRL---SALN-----DV----DTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L---~~~~-----~~----~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+++|.++.++++.+++   ....     ..    .+-++|..|.|||+||+.+.
T Consensus        55 ~di~g~~~~k~~l~~~~~~l~~~~~~~~~g~~~~~giLL~GppGtGKT~la~alA  109 (495)
T TIGR01241        55 KDVAGIDEAKEELMEIVDFLKNPSKFTKLGAKIPKGVLLVGPPGTGKTLLAKAVA  109 (495)
T ss_pred             HHhCCHHHHHHHHHHHHHHHHCHHHHHhcCCCCCCcEEEECCCCCCHHHHHHHHH
Confidence            46889887776665543   2211     01    22677999999999999874


No 93 
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=94.53  E-value=0.025  Score=41.51  Aligned_cols=18  Identities=33%  Similarity=0.414  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        34 ~l~G~nGsGKSTLl~~i~   51 (218)
T cd03255          34 AIVGPSGSGKSTLLNILG   51 (218)
T ss_pred             EEEcCCCCCHHHHHHHHh
Confidence            999999999999999864


No 94 
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit. This model represents the ATPase subunit of HslVU, while the proteasome-related peptidase subunit is HslV. Residues 54-61 of the model contain a P-loop ATP-binding motif. Cys-287 of E. coli (position 308 in the seed alignment), studied in PubMed:98389714, is Ser in other members of the seed alignment.
Probab=94.52  E-value=0.037  Score=46.86  Aligned_cols=42  Identities=19%  Similarity=0.474  Sum_probs=31.0

Q ss_pred             CceeecchhHHHHHHHHhcC-----------CC---CCcceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSAL-----------ND---VDTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~-----------~~---~~~~IvGmGGiGKTTLA~~V  103 (106)
                      ..++|.++.++.+...+...           ..   .++-++|..|+|||+||+.+
T Consensus        12 ~~IiGQ~eAkk~lsvAl~n~~~r~~~~~~~~~e~~p~~ILLiGppG~GKT~lAraL   67 (441)
T TIGR00390        12 KYIIGQDNAKKSVAIALRNRYRRSQLNEELKDEVTPKNILMIGPTGVGKTEIARRL   67 (441)
T ss_pred             hhccCHHHHHHHHHHHHHhhhhhhccccccccccCCceEEEECCCCCCHHHHHHHH
Confidence            47999999888886555421           00   12378899999999999975


No 95 
>PRK09112 DNA polymerase III subunit delta'; Validated
Probab=94.49  E-value=0.048  Score=44.29  Aligned_cols=42  Identities=12%  Similarity=0.154  Sum_probs=33.9

Q ss_pred             CceeecchhHHHHHHHHhcCCCCC-cceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVD-TVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~-~~IvGmGGiGKTTLA~~V  103 (106)
                      ..++|.++-.+.+...+...+-.. +-|.|.-|+||||||..+
T Consensus        23 ~~l~Gh~~a~~~L~~a~~~grl~ha~L~~G~~G~GKttlA~~l   65 (351)
T PRK09112         23 TRLFGHEEAEAFLAQAYREGKLHHALLFEGPEGIGKATLAFHL   65 (351)
T ss_pred             hhccCcHHHHHHHHHHHHcCCCCeeEeeECCCCCCHHHHHHHH
Confidence            579999998888888886655433 378899999999999864


No 96 
>PRK06305 DNA polymerase III subunits gamma and tau; Validated
Probab=94.49  E-value=0.041  Score=45.98  Aligned_cols=42  Identities=21%  Similarity=0.222  Sum_probs=33.3

Q ss_pred             CceeecchhHHHHHHHHhcCCCCC-cceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVD-TVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~-~~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.+..++.|.+.+....... +-++|..|+||||+|+.+
T Consensus        17 ~diiGq~~~v~~L~~~i~~~~i~ha~Lf~Gp~G~GKtt~A~~l   59 (451)
T PRK06305         17 SEILGQDAVVAVLKNALRFNRAAHAYLFSGIRGTGKTTLARIF   59 (451)
T ss_pred             HHhcCcHHHHHHHHHHHHcCCCceEEEEEcCCCCCHHHHHHHH
Confidence            469999998888888886544333 267899999999999865


No 97 
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair]
Probab=94.45  E-value=0.017  Score=47.17  Aligned_cols=19  Identities=26%  Similarity=0.537  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhhc
Q 046733           87 VIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy~  105 (106)
                      -++||.|.||||..|.++.
T Consensus        23 lVvGMAGSGKTTF~QrL~~   41 (366)
T KOG1532|consen   23 LVVGMAGSGKTTFMQRLNS   41 (366)
T ss_pred             EEEecCCCCchhHHHHHHH
Confidence            7789999999999998764


No 98 
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional
Probab=94.43  E-value=0.038  Score=45.90  Aligned_cols=43  Identities=12%  Similarity=0.308  Sum_probs=30.0

Q ss_pred             CceeecchhHHHHHHHHhc-------C-C--------CCCcceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSA-------L-N--------DVDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~-------~-~--------~~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      ..|+|.++.++.|...+..       . .        ..++-++|..|+|||+||+.+.
T Consensus        71 ~~ViGq~~ak~~l~~av~~~~~r~~~~~~~~~~~~~~~~~iLl~Gp~GtGKT~lAr~lA  129 (412)
T PRK05342         71 QYVIGQERAKKVLSVAVYNHYKRLRHGDKKDDDVELQKSNILLIGPTGSGKTLLAQTLA  129 (412)
T ss_pred             hHeeChHHHHHHHHHHHHHHHHhhhcccccccccccCCceEEEEcCCCCCHHHHHHHHH
Confidence            3699999888877443311       0 0        0123788999999999999864


No 99 
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=94.40  E-value=0.027  Score=41.08  Aligned_cols=18  Identities=33%  Similarity=0.525  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        31 ~l~G~nGsGKSTLl~~l~   48 (211)
T cd03225          31 LIVGPNGSGKSTLLRLLN   48 (211)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999874


No 100
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=94.36  E-value=0.06  Score=39.17  Aligned_cols=34  Identities=15%  Similarity=0.132  Sum_probs=23.0

Q ss_pred             hHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhhh
Q 046733           70 DRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        70 ~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +...++...... ...+.|+|..|.|||||.+.+.
T Consensus        13 ~~~~~l~~~v~~-g~~i~I~G~tGSGKTTll~aL~   46 (186)
T cd01130          13 LQAAYLWLAVEA-RKNILISGGTGSGKTTLLNALL   46 (186)
T ss_pred             HHHHHHHHHHhC-CCEEEEECCCCCCHHHHHHHHH
Confidence            344445444432 2234999999999999998764


No 101
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional
Probab=94.34  E-value=0.05  Score=46.06  Aligned_cols=42  Identities=17%  Similarity=0.181  Sum_probs=33.4

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.+.-++.|.+.+........ -+.|..|+||||+|+.+
T Consensus        16 ~diiGq~~i~~~L~~~i~~~~i~hayLf~Gp~G~GKTtlAr~l   58 (486)
T PRK14953         16 KEVIGQEIVVRILKNAVKLQRVSHAYIFAGPRGTGKTTIARIL   58 (486)
T ss_pred             HHccChHHHHHHHHHHHHcCCCCeEEEEECCCCCCHHHHHHHH
Confidence            3689999999999888866443333 57899999999999874


No 102
>PRK09087 hypothetical protein; Validated
Probab=94.33  E-value=0.029  Score=42.67  Aligned_cols=19  Identities=26%  Similarity=0.188  Sum_probs=17.0

Q ss_pred             cceEecCCCcHHHHHHhhh
Q 046733           86 TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +-|+|..|+|||+|++..+
T Consensus        47 l~l~G~~GsGKThLl~~~~   65 (226)
T PRK09087         47 VVLAGPVGSGKTHLASIWR   65 (226)
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            3899999999999999765


No 103
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein.
Probab=94.32  E-value=0.029  Score=41.20  Aligned_cols=18  Identities=39%  Similarity=0.521  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        33 ~i~G~nGsGKSTLl~~l~   50 (216)
T TIGR00960        33 FLVGHSGAGKSTFLKLIL   50 (216)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 104
>PRK07940 DNA polymerase III subunit delta'; Validated
Probab=94.29  E-value=0.049  Score=45.00  Aligned_cols=42  Identities=14%  Similarity=0.116  Sum_probs=32.3

Q ss_pred             CceeecchhHHHHHHHHhcCC---------CC-CcceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALN---------DV-DTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~---------~~-~~~IvGmGGiGKTTLA~~V  103 (106)
                      .+|+|.+.-++.|.+.+....         .. .+-++|..|+|||++|..+
T Consensus         5 ~~IiGq~~~~~~L~~~i~~~~~~~~~~~~~l~ha~Lf~Gp~G~GKt~lA~~l   56 (394)
T PRK07940          5 DDLVGQEAVVAELRAAARAARADVAAAGSGMTHAWLFTGPPGSGRSVAARAF   56 (394)
T ss_pred             hhccChHHHHHHHHHHHHhccccccccCCCCCeEEEEECCCCCcHHHHHHHH
Confidence            468999988888888886543         11 1257899999999999864


No 105
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional
Probab=94.26  E-value=0.056  Score=43.06  Aligned_cols=44  Identities=18%  Similarity=0.344  Sum_probs=35.2

Q ss_pred             CceeecchhHHHHHHHHhcCCCC--CcceEecCCCcHHHHHHhhhc
Q 046733           62 KFAYGRDGDRNKIINRLSALNDV--DTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~--~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      ..++|.......+.+.+..-...  .+-|+|-.|.||+++|+.++.
T Consensus         6 ~~liG~S~~~~~~~~~i~~~a~~~~pVlI~GE~GtGK~~lA~~iH~   51 (326)
T PRK11608          6 DNLLGEANSFLEVLEQVSRLAPLDKPVLIIGERGTGKELIASRLHY   51 (326)
T ss_pred             CccEECCHHHHHHHHHHHHHhCCCCCEEEECCCCCcHHHHHHHHHH
Confidence            46899998888888887543332  358889999999999999874


No 106
>PRK07471 DNA polymerase III subunit delta'; Validated
Probab=94.25  E-value=0.059  Score=43.99  Aligned_cols=41  Identities=15%  Similarity=0.195  Sum_probs=33.1

Q ss_pred             CceeecchhHHHHHHHHhcCCCCC-cceEecCCCcHHHHHHh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVD-TVIVGIGGLGKIVVWKN  102 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~-~~IvGmGGiGKTTLA~~  102 (106)
                      .+++|.++-++.|.+.+...+-.. +-+.|..|+||+|||..
T Consensus        19 ~~iiGq~~~~~~L~~~~~~~rl~HA~Lf~Gp~G~GK~~lA~~   60 (365)
T PRK07471         19 TALFGHAAAEAALLDAYRSGRLHHAWLIGGPQGIGKATLAYR   60 (365)
T ss_pred             hhccChHHHHHHHHHHHHcCCCCceEEEECCCCCCHHHHHHH
Confidence            479999988888888887655443 37889999999999975


No 107
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds.  Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders.  The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis.  The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle.  The ABCA genes are not present in yeast.  However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.
Probab=94.21  E-value=0.031  Score=41.01  Aligned_cols=18  Identities=28%  Similarity=0.407  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        32 ~i~G~nGsGKSTLl~~l~   49 (220)
T cd03263          32 GLLGHNGAGKTTTLKMLT   49 (220)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999875


No 108
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.19  E-value=0.032  Score=41.57  Aligned_cols=18  Identities=33%  Similarity=0.516  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        30 ~l~G~nGsGKSTLl~~l~   47 (235)
T cd03261          30 AIIGPSGSGKSTLLRLIV   47 (235)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 109
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system.  Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond.  Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond.  Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.10  E-value=0.033  Score=41.36  Aligned_cols=18  Identities=22%  Similarity=0.505  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        31 ~i~G~nGsGKSTLl~~l~   48 (241)
T cd03256          31 ALIGPSGAGKSTLLRCLN   48 (241)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 110
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN. Members of this family are the GvpN protein associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy. This family belongs to a larger family of ATPases (pfam07728).
Probab=94.09  E-value=0.063  Score=41.34  Aligned_cols=19  Identities=21%  Similarity=0.295  Sum_probs=16.6

Q ss_pred             cceEecCCCcHHHHHHhhh
Q 046733           86 TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +-+.|..|+|||+||+.+.
T Consensus        24 vLL~G~~GtGKT~lA~~la   42 (262)
T TIGR02640        24 VHLRGPAGTGKTTLAMHVA   42 (262)
T ss_pred             EEEEcCCCCCHHHHHHHHH
Confidence            3778999999999999864


No 111
>TIGR02673 FtsE cell division ATP-binding protein FtsE. This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein.
Probab=94.09  E-value=0.034  Score=40.69  Aligned_cols=18  Identities=33%  Similarity=0.626  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        32 ~l~G~nGsGKSTLl~~i~   49 (214)
T TIGR02673        32 FLTGPSGAGKTTLLKLLY   49 (214)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999764


No 112
>TIGR00763 lon ATP-dependent protease La. This protein is induced by heat shock and other stresses in E. coli, B. subtilis, and other species. The yeast member, designated PIM1, is located in the mitochondrial matrix, required for mitochondrial function, and also induced by heat shock.
Probab=94.07  E-value=0.044  Score=48.51  Aligned_cols=43  Identities=26%  Similarity=0.338  Sum_probs=32.3

Q ss_pred             CceeecchhHHHHHHHHhcC----CCC-C-cceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSAL----NDV-D-TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~----~~~-~-~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+++|.++-++.|.+++...    ... . +-++|..|+|||+||+.+-
T Consensus       320 ~~~~G~~~~k~~i~~~~~~~~~~~~~~~~~lll~GppG~GKT~lAk~iA  368 (775)
T TIGR00763       320 EDHYGLKKVKERILEYLAVQKLRGKMKGPILCLVGPPGVGKTSLGKSIA  368 (775)
T ss_pred             hhcCChHHHHHHHHHHHHHHHhhcCCCCceEEEECCCCCCHHHHHHHHH
Confidence            46899999999998876421    111 1 2788999999999999763


No 113
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.05  E-value=0.037  Score=39.79  Aligned_cols=18  Identities=28%  Similarity=0.471  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~i~G~nGsGKSTLl~~l~   47 (178)
T cd03229          30 ALLGPSGSGKSTLLRCIA   47 (178)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999864


No 114
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component.  The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.04  E-value=0.036  Score=40.54  Aligned_cols=19  Identities=21%  Similarity=0.347  Sum_probs=17.1

Q ss_pred             cceEecCCCcHHHHHHhhh
Q 046733           86 TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +.|+|..|.|||||.+.+.
T Consensus        28 ~~i~G~nGsGKSTLl~~l~   46 (211)
T cd03264          28 YGLLGPNGAGKTTLMRILA   46 (211)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3999999999999999875


No 115
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.03  E-value=0.036  Score=40.88  Aligned_cols=18  Identities=33%  Similarity=0.494  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        34 ~i~G~nGsGKSTLl~~l~   51 (220)
T cd03293          34 ALVGPSGCGKSTLLRIIA   51 (220)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999874


No 116
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane.  The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=94.03  E-value=0.035  Score=40.49  Aligned_cols=18  Identities=44%  Similarity=0.689  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        31 ~i~G~nGsGKSTLl~~l~   48 (214)
T cd03292          31 FLVGPSGAGKSTLLKLIY   48 (214)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 117
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup.  This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.   ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.02  E-value=0.036  Score=40.56  Aligned_cols=18  Identities=28%  Similarity=0.482  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~i~G~nGsGKSTLl~~l~   47 (213)
T cd03259          30 ALLGPSGCGKTTLLRLIA   47 (213)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999864


No 118
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit. This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.
Probab=94.01  E-value=0.036  Score=39.98  Aligned_cols=18  Identities=22%  Similarity=0.481  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        22 ~i~G~nGsGKSTLl~~i~   39 (190)
T TIGR01166        22 ALLGANGAGKSTLLLHLN   39 (190)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999764


No 119
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein. Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.
Probab=93.99  E-value=0.036  Score=41.28  Aligned_cols=18  Identities=33%  Similarity=0.549  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        32 ~l~G~nGsGKSTLl~~l~   49 (243)
T TIGR02315        32 AIIGPSGAGKSTLLRCIN   49 (243)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 120
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient.  The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes.  The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system.  PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein.  PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).
Probab=93.99  E-value=0.037  Score=40.91  Aligned_cols=18  Identities=22%  Similarity=0.477  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~i~G~nGsGKSTLl~~i~   47 (227)
T cd03260          30 ALIGPSGCGKSTLLRLLN   47 (227)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999999864


No 121
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity.  In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs.  Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=93.98  E-value=0.037  Score=40.47  Aligned_cols=18  Identities=28%  Similarity=0.427  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~i~G~nGsGKSTLl~~l~   47 (210)
T cd03269          30 GLLGPNGAGKTTTIRMIL   47 (210)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999763


No 122
>TIGR01817 nifA Nif-specific regulatory protein. This model represents NifA, a DNA-binding regulatory protein for nitrogen fixation. The model produces scores between the trusted and noise cutoffs for a well-described NifA homolog in Aquifex aeolicus (which lacks nitrogenase), for transcriptional activators of alternative nitrogenases (VFe or FeFe instead of MoFe), and truncated forms.
Probab=93.98  E-value=0.07  Score=44.91  Aligned_cols=44  Identities=16%  Similarity=0.305  Sum_probs=35.5

Q ss_pred             CceeecchhHHHHHHHHhcCCCC--CcceEecCCCcHHHHHHhhhc
Q 046733           62 KFAYGRDGDRNKIINRLSALNDV--DTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~--~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      ..++|......++++.+..-...  .+-|+|-.|.||+++|+.+++
T Consensus       196 ~~liG~s~~~~~~~~~~~~~a~~~~pvli~Ge~GtGK~~lA~~ih~  241 (534)
T TIGR01817       196 DGIIGKSPAMRQVVDQARVVARSNSTVLLRGESGTGKELIAKAIHY  241 (534)
T ss_pred             CceEECCHHHHHHHHHHHHHhCcCCCEEEECCCCccHHHHHHHHHH
Confidence            47999999999998887543322  348889999999999999875


No 123
>PTZ00112 origin recognition complex 1 protein; Provisional
Probab=93.97  E-value=0.081  Score=49.00  Aligned_cols=43  Identities=19%  Similarity=0.269  Sum_probs=33.7

Q ss_pred             CceeecchhHHHHHHHHhc---CC-CCCc-ceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSA---LN-DVDT-VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~---~~-~~~~-~IvGmGGiGKTTLA~~Vy  104 (106)
                      ..+.||+++.+.|...|..   .. ..++ -|.|..|.|||++++.|.
T Consensus       755 D~LPhREeEIeeLasfL~paIkgsgpnnvLYIyG~PGTGKTATVK~VL  802 (1164)
T PTZ00112        755 KYLPCREKEIKEVHGFLESGIKQSGSNQILYISGMPGTGKTATVYSVI  802 (1164)
T ss_pred             CcCCChHHHHHHHHHHHHHHHhcCCCCceEEEECCCCCCHHHHHHHHH
Confidence            4789999999999888743   11 1233 589999999999999874


No 124
>PRK05563 DNA polymerase III subunits gamma and tau; Validated
Probab=93.97  E-value=0.063  Score=46.09  Aligned_cols=42  Identities=17%  Similarity=0.140  Sum_probs=33.8

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.+.-++.|.+.+...+..+. =+.|..|+||||+|+.+
T Consensus        16 ~~viGq~~v~~~L~~~i~~~~~~hayLf~Gp~GtGKTt~Ak~l   58 (559)
T PRK05563         16 EDVVGQEHITKTLKNAIKQGKISHAYLFSGPRGTGKTSAAKIF   58 (559)
T ss_pred             HhccCcHHHHHHHHHHHHcCCCCeEEEEECCCCCCHHHHHHHH
Confidence            4699999999999888876544433 56899999999999864


No 125
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]
Probab=93.96  E-value=0.089  Score=43.06  Aligned_cols=42  Identities=21%  Similarity=0.232  Sum_probs=33.5

Q ss_pred             ceeecchhHHHHHHHHhc----CCCCCcceEecCCCcHHHHHHhhh
Q 046733           63 FAYGRDGDRNKIINRLSA----LNDVDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        63 ~vvGrd~~~~~lv~~L~~----~~~~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+.+|+++.+.+...|..    ....++-|.|..|.|||+.++.|.
T Consensus        18 ~l~~Re~ei~~l~~~l~~~~~~~~p~n~~iyG~~GTGKT~~~~~v~   63 (366)
T COG1474          18 ELPHREEEINQLASFLAPALRGERPSNIIIYGPTGTGKTATVKFVM   63 (366)
T ss_pred             cccccHHHHHHHHHHHHHHhcCCCCccEEEECCCCCCHhHHHHHHH
Confidence            588999999999887743    122245888999999999999875


No 126
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional
Probab=93.95  E-value=0.066  Score=45.36  Aligned_cols=42  Identities=19%  Similarity=0.426  Sum_probs=31.9

Q ss_pred             CceeecchhHHHHHHHHhcC--------C------CCCcceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSAL--------N------DVDTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~--------~------~~~~~IvGmGGiGKTTLA~~V  103 (106)
                      ..++|.++.++.+...+...        .      ..++-++|..|+||||||+.+
T Consensus        15 ~~IiGQe~AkkalavAl~~~~~r~~l~~~~~~e~~~~~ILliGp~G~GKT~LAr~L   70 (443)
T PRK05201         15 KYIIGQDDAKRAVAIALRNRWRRMQLPEELRDEVTPKNILMIGPTGVGKTEIARRL   70 (443)
T ss_pred             cccCCHHHHHHHHHHHHHHHHHHhcCCcccccccCCceEEEECCCCCCHHHHHHHH
Confidence            47999999999987776431        0      112378899999999999965


No 127
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=93.95  E-value=0.036  Score=43.88  Aligned_cols=17  Identities=35%  Similarity=0.425  Sum_probs=16.1

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .|+|-.|.|||||++.+
T Consensus        37 givGeSGsGKSTL~r~l   53 (252)
T COG1124          37 GIVGESGSGKSTLARLL   53 (252)
T ss_pred             EEEcCCCCCHHHHHHHH
Confidence            99999999999999975


No 128
>PTZ00133 ADP-ribosylation factor; Provisional
Probab=93.93  E-value=0.072  Score=38.28  Aligned_cols=19  Identities=21%  Similarity=0.504  Sum_probs=16.8

Q ss_pred             CcceEecCCCcHHHHHHhh
Q 046733           85 DTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        85 ~~~IvGmGGiGKTTLA~~V  103 (106)
                      ++.++|.+|+|||||...+
T Consensus        19 kv~lvG~~~vGKTsli~~~   37 (182)
T PTZ00133         19 RILMVGLDAAGKTTILYKL   37 (182)
T ss_pred             EEEEEcCCCCCHHHHHHHH
Confidence            4589999999999999875


No 129
>PF14532 Sigma54_activ_2:  Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H.
Probab=93.91  E-value=0.045  Score=37.85  Aligned_cols=41  Identities=20%  Similarity=0.320  Sum_probs=27.8

Q ss_pred             eecchhHHHHHHHHhcCC--CCCcceEecCCCcHHHHHHhhhc
Q 046733           65 YGRDGDRNKIINRLSALN--DVDTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        65 vGrd~~~~~lv~~L~~~~--~~~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      ||.-...+++.+.+..-.  ...+-|.|-.|.||+++|+.+++
T Consensus         1 vG~S~~~~~l~~~l~~~a~~~~pvli~GE~GtGK~~~A~~lh~   43 (138)
T PF14532_consen    1 VGKSPAMRRLRRQLERLAKSSSPVLITGEPGTGKSLLARALHR   43 (138)
T ss_dssp             --SCHHHHHHHHHHHHHHCSSS-EEEECCTTSSHHHHHHCCHH
T ss_pred             CCCCHHHHHHHHHHHHHhCCCCcEEEEcCCCCCHHHHHHHHHh
Confidence            455666677776664322  22348889999999999998875


No 130
>PRK10787 DNA-binding ATP-dependent protease La; Provisional
Probab=93.90  E-value=0.072  Score=47.61  Aligned_cols=43  Identities=23%  Similarity=0.365  Sum_probs=33.7

Q ss_pred             CceeecchhHHHHHHHHhcCC-----CCCc-ceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALN-----DVDT-VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~-----~~~~-~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+.+|.++-+++|+++|....     .... -++|..|+||||+|+.+.
T Consensus       322 ~~~~g~~~vK~~i~~~l~~~~~~~~~~g~~i~l~GppG~GKTtl~~~ia  370 (784)
T PRK10787        322 TDHYGLERVKDRILEYLAVQSRVNKIKGPILCLVGPPGVGKTSLGQSIA  370 (784)
T ss_pred             hhccCHHHHHHHHHHHHHHHHhcccCCCceEEEECCCCCCHHHHHHHHH
Confidence            479999999999999885311     1122 788999999999999764


No 131
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional
Probab=93.88  E-value=0.04  Score=40.76  Aligned_cols=18  Identities=22%  Similarity=0.396  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        40 ~i~G~nGsGKSTLl~~i~   57 (228)
T PRK10584         40 ALIGESGSGKSTLLAILA   57 (228)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999999875


No 132
>PF05673 DUF815:  Protein of unknown function (DUF815);  InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function.
Probab=93.88  E-value=0.067  Score=42.24  Aligned_cols=43  Identities=16%  Similarity=0.210  Sum_probs=33.1

Q ss_pred             CceeecchhHHHHHHHH---hcC-CCCCcceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRL---SAL-NDVDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L---~~~-~~~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+++|.+.+++.|++-.   ... ...++=++|.-|.|||+|++++.
T Consensus        27 ~~L~Gie~Qk~~l~~Nt~~Fl~G~pannvLL~G~rGtGKSSlVkall   73 (249)
T PF05673_consen   27 DDLIGIERQKEALIENTEQFLQGLPANNVLLWGARGTGKSSLVKALL   73 (249)
T ss_pred             HHhcCHHHHHHHHHHHHHHHHcCCCCcceEEecCCCCCHHHHHHHHH
Confidence            57999999999987643   222 22345889999999999999875


No 133
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function.  Barmotin belongs to the SMC protein family.  SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w
Probab=93.88  E-value=0.034  Score=41.16  Aligned_cols=19  Identities=42%  Similarity=0.704  Sum_probs=17.5

Q ss_pred             ceEecCCCcHHHHHHhhhc
Q 046733           87 VIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy~  105 (106)
                      .|+|..|.|||||.+++++
T Consensus        26 ~i~G~nGsGKStll~al~~   44 (197)
T cd03278          26 AIVGPNGSGKSNIIDAIRW   44 (197)
T ss_pred             EEECCCCCCHHHHHHHHHH
Confidence            8999999999999999864


No 134
>TIGR00554 panK_bact pantothenate kinase, bacterial type. Shown to be a homodimer in E. coli. This enzyme catalyzes the rate-limiting step in the biosynthesis of coenzyme A. It is very well conserved from E. coli to B. subtilis, but differs considerably from known eukaryotic forms, described in a separate model.
Probab=93.85  E-value=0.083  Score=42.11  Aligned_cols=17  Identities=24%  Similarity=0.276  Sum_probs=15.5

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .|.|..|+||||||+.+
T Consensus        66 GIaG~~GSGKSTlar~L   82 (290)
T TIGR00554        66 SIAGSVAVGKSTTARIL   82 (290)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            89999999999999864


No 135
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system. Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification.
Probab=93.83  E-value=0.041  Score=41.07  Aligned_cols=18  Identities=22%  Similarity=0.481  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        31 ~i~G~nGsGKSTLl~~l~   48 (236)
T TIGR03864        31 ALLGPNGAGKSTLFSLLT   48 (236)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999874


No 136
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=93.82  E-value=0.04  Score=40.44  Aligned_cols=18  Identities=33%  Similarity=0.449  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        27 ~i~G~nGsGKSTLl~~l~   44 (214)
T cd03297          27 GIFGASGAGKSTLLRCIA   44 (214)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 137
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport.  Other members of this system include the MetP permease and  the MetQ substrate binding protein.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=93.82  E-value=0.041  Score=40.83  Aligned_cols=18  Identities=33%  Similarity=0.470  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        35 ~l~G~nGsGKSTLl~~l~   52 (233)
T cd03258          35 GIIGRSGAGKSTLIRCIN   52 (233)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 138
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK.  ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles.  ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP.  In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.
Probab=93.81  E-value=0.041  Score=40.19  Aligned_cols=18  Identities=33%  Similarity=0.525  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~l~G~nGsGKSTLl~~l~   47 (213)
T cd03301          30 VLLGPSGCGKTTTLRMIA   47 (213)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999764


No 139
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import.  Responsible for energy coupling to the transport system.  The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=93.79  E-value=0.042  Score=41.11  Aligned_cols=18  Identities=28%  Similarity=0.471  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        32 ~i~G~nGsGKSTLl~~l~   49 (239)
T cd03296          32 ALLGPSGSGKTTLLRLIA   49 (239)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 140
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters.  This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc.  The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor.  The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri.  Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.
Probab=93.79  E-value=0.041  Score=40.30  Aligned_cols=18  Identities=44%  Similarity=0.617  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        29 ~l~G~nGsGKSTLl~~l~   46 (213)
T cd03235          29 AIVGPNGAGKSTLLKAIL   46 (213)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            999999999999999763


No 141
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional
Probab=93.79  E-value=0.042  Score=39.97  Aligned_cols=18  Identities=33%  Similarity=0.425  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~l~G~nGsGKSTLl~~l~   47 (195)
T PRK13541         30 YIKGANGCGKSSLLRMIA   47 (195)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999764


No 142
>TIGR00455 apsK adenylylsulfate kinase (apsK). Important residue (active site in E.coli) is residue 100 of the seed alignment.
Probab=93.79  E-value=0.042  Score=39.49  Aligned_cols=18  Identities=22%  Similarity=0.420  Sum_probs=16.3

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|.|..|.||||||+.+.
T Consensus        22 ~i~G~~GsGKstla~~l~   39 (184)
T TIGR00455        22 WLTGLSGSGKSTIANALE   39 (184)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            888999999999999764


No 143
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin.  In addition to DrrA, the complex includes an integral membrane protein called DrrB.  DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called  P-glycoprotein.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=93.78  E-value=0.041  Score=40.54  Aligned_cols=18  Identities=28%  Similarity=0.379  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~i~G~nGsGKSTLl~~i~   47 (220)
T cd03265          30 GLLGPNGAGKTTTIKMLT   47 (220)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 144
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=93.77  E-value=0.043  Score=40.04  Aligned_cols=18  Identities=28%  Similarity=0.401  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~i~G~nGsGKSTLl~~l~   47 (205)
T cd03226          30 ALTGKNGAGKTTLAKILA   47 (205)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999874


No 145
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein. This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina.
Probab=93.75  E-value=0.044  Score=40.27  Aligned_cols=18  Identities=33%  Similarity=0.422  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        35 ~i~G~nGsGKSTLl~~i~   52 (221)
T TIGR02211        35 AIVGSSGSGKSTLLHLLG   52 (221)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999874


No 146
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional
Probab=93.74  E-value=0.044  Score=40.84  Aligned_cols=18  Identities=33%  Similarity=0.422  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        39 ~l~G~nGsGKSTLl~~l~   56 (233)
T PRK11629         39 AIVGSSGSGKSTLLHLLG   56 (233)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999874


No 147
>PF13476 AAA_23:  AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A.
Probab=93.73  E-value=0.05  Score=38.22  Aligned_cols=19  Identities=37%  Similarity=0.576  Sum_probs=17.4

Q ss_pred             ceEecCCCcHHHHHHhhhc
Q 046733           87 VIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy~  105 (106)
                      .|+|..|.||||++.+|.+
T Consensus        23 vi~G~Ng~GKStil~ai~~   41 (202)
T PF13476_consen   23 VIYGPNGSGKSTILEAIRY   41 (202)
T ss_dssp             EEEESTTSSHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHH
Confidence            8899999999999998765


No 148
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine.  MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli  branched-chain amino acid transporter.  MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs.  The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).
Probab=93.68  E-value=0.043  Score=40.69  Aligned_cols=18  Identities=28%  Similarity=0.499  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~l~G~nGsGKSTLl~~l~   47 (236)
T cd03219          30 GLIGPNGAGKTTLFNLIS   47 (236)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            999999999999999864


No 149
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily. This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.
Probab=93.68  E-value=0.059  Score=47.21  Aligned_cols=43  Identities=19%  Similarity=0.187  Sum_probs=31.1

Q ss_pred             CceeecchhHHHHHHHHhcC---C----C------CCcceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSAL---N----D------VDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~---~----~------~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .++.|.++.++.|.+++...   .    .      ..+-++|..|.||||||+.+.
T Consensus       178 ~di~G~~~~~~~l~~~i~~~~~~~~~~~~~gi~~~~giLL~GppGtGKT~laraia  233 (733)
T TIGR01243       178 EDIGGLKEAKEKIREMVELPMKHPELFEHLGIEPPKGVLLYGPPGTGKTLLAKAVA  233 (733)
T ss_pred             HHhcCHHHHHHHHHHHHHHHhhCHHHHHhcCCCCCceEEEECCCCCChHHHHHHHH
Confidence            35889998888887765321   0    0      112688999999999999875


No 150
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural
Probab=93.66  E-value=0.047  Score=37.78  Aligned_cols=17  Identities=29%  Similarity=0.501  Sum_probs=15.7

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .|+|..|.|||||++.+
T Consensus        19 ~I~GpSGsGKSTLl~~l   35 (107)
T cd00820          19 LITGDSGIGKTELALEL   35 (107)
T ss_pred             EEEcCCCCCHHHHHHHh
Confidence            89999999999999874


No 151
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE).  The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis.  The molecular mechanism of nickel uptake in many bacteria and most archaea is not known.  Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides.  The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.
Probab=93.64  E-value=0.045  Score=40.22  Aligned_cols=18  Identities=33%  Similarity=0.451  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        35 ~i~G~nGsGKSTLl~~l~   52 (228)
T cd03257          35 GLVGESGSGKSTLARAIL   52 (228)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999764


No 152
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional
Probab=93.64  E-value=0.047  Score=39.98  Aligned_cols=18  Identities=28%  Similarity=0.375  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        31 ~l~G~nGsGKSTLl~~l~   48 (204)
T PRK13538         31 QIEGPNGAGKTSLLRILA   48 (204)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999874


No 153
>TIGR03689 pup_AAA proteasome ATPase. In the Actinobacteria, as shown for Mycobacterium tuberculosis, some proteins are modified by ligation between an epsilon-amino group of a lysine side chain and the C-terminal carboxylate of the ubiquitin-like protein Pup. This modification leads to protein degradation by the archaeal-like proteasome found in the Actinobacteria. Members of this protein family belong to the AAA family of ATPases and tend to be clustered with the genes for Pup, the Pup ligase PafA, and structural components of the proteasome. This protein forms hexameric rings with ATPase activity.
Probab=93.63  E-value=0.077  Score=45.51  Aligned_cols=44  Identities=18%  Similarity=0.186  Sum_probs=31.9

Q ss_pred             CceeecchhHHHHHHHHhcC---C----C------CCcceEecCCCcHHHHHHhhhc
Q 046733           62 KFAYGRDGDRNKIINRLSAL---N----D------VDTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~---~----~------~~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      .++.|.+..++.|.+.+...   .    .      ..+-++|..|.|||++|+++++
T Consensus       182 ~dIgGl~~~i~~i~~~v~lp~~~~~l~~~~gl~~p~GILLyGPPGTGKT~LAKAlA~  238 (512)
T TIGR03689       182 ADIGGLDSQIEQIRDAVELPFLHPELYREYDLKPPKGVLLYGPPGCGKTLIAKAVAN  238 (512)
T ss_pred             HHcCChHHHHHHHHHHHHHHhhCHHHHHhccCCCCcceEEECCCCCcHHHHHHHHHH
Confidence            45778998888887765321   0    0      1236789999999999999864


No 154
>PRK06647 DNA polymerase III subunits gamma and tau; Validated
Probab=93.63  E-value=0.084  Score=45.54  Aligned_cols=42  Identities=14%  Similarity=0.177  Sum_probs=33.9

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.+.-+..|..++...+-... -+.|..|.||||+|+.+
T Consensus        16 ~diiGqe~iv~~L~~~i~~~~i~hayLf~Gp~G~GKTt~Ar~l   58 (563)
T PRK06647         16 NSLEGQDFVVETLKHSIESNKIANAYIFSGPRGVGKTSSARAF   58 (563)
T ss_pred             HHccCcHHHHHHHHHHHHcCCCCeEEEEECCCCCCHHHHHHHH
Confidence            4699999999999988876543332 68899999999999875


No 155
>PRK14738 gmk guanylate kinase; Provisional
Probab=93.62  E-value=0.049  Score=40.47  Aligned_cols=18  Identities=39%  Similarity=0.530  Sum_probs=16.2

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|+|||||++.+.
T Consensus        17 vi~GpsG~GK~tl~~~L~   34 (206)
T PRK14738         17 VISGPSGVGKDAVLARMR   34 (206)
T ss_pred             EEECcCCCCHHHHHHHHH
Confidence            689999999999999874


No 156
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.
Probab=93.61  E-value=0.046  Score=40.07  Aligned_cols=18  Identities=22%  Similarity=0.385  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        35 ~i~G~nGsGKSTLl~~l~   52 (218)
T cd03266          35 GLLGPNGAGKTTTLRMLA   52 (218)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 157
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional
Probab=93.60  E-value=0.078  Score=45.64  Aligned_cols=42  Identities=14%  Similarity=0.197  Sum_probs=33.3

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.++-++.|.+.+........ -+.|..|+||||+|+.+
T Consensus        16 ~~iiGq~~v~~~L~~~i~~~~~~hayLf~Gp~G~GKtt~A~~l   58 (576)
T PRK14965         16 SDLTGQEHVSRTLQNAIDTGRVAHAFLFTGARGVGKTSTARIL   58 (576)
T ss_pred             HHccCcHHHHHHHHHHHHcCCCCeEEEEECCCCCCHHHHHHHH
Confidence            4699999888888888866543332 57899999999999875


No 158
>smart00178 SAR Sar1p-like members of the Ras-family  of small GTPases. Yeast SAR1 is an essential gene required for transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus.
Probab=93.60  E-value=0.091  Score=37.67  Aligned_cols=32  Identities=16%  Similarity=0.331  Sum_probs=21.4

Q ss_pred             HHHHHHHhc-CCCCCcceEecCCCcHHHHHHhh
Q 046733           72 NKIINRLSA-LNDVDTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        72 ~~lv~~L~~-~~~~~~~IvGmGGiGKTTLA~~V  103 (106)
                      .++.+++.. ....++.|+|..|+|||||...+
T Consensus         5 ~~~~~~~~~~~~~~~i~ivG~~~~GKTsli~~l   37 (184)
T smart00178        5 YDILASLGLWNKHAKILFLGLDNAGKTTLLHML   37 (184)
T ss_pred             HHHHHHhccccccCEEEEECCCCCCHHHHHHHH
Confidence            344554322 22234599999999999998865


No 159
>TIGR01978 sufC FeS assembly ATPase SufC. SufC is part of the SUF system, shown in E. coli to consist of six proteins and believed to act in Fe-S cluster formation during oxidative stress. SufC forms a complex with SufB and SufD. SufC belongs to the ATP-binding cassette transporter family (pfam00005) but is no longer thought to be part of a transporter. The complex is reported as cytosolic (PubMed:12554644) or associated with the membrane (PubMed:11943156). The SUF system also includes a cysteine desulfurase (SufS, enhanced by SufE) and a probable iron-sulfur cluster assembly scaffold protein, SufA.
Probab=93.59  E-value=0.046  Score=40.62  Aligned_cols=18  Identities=39%  Similarity=0.493  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~i~G~nGsGKSTLl~~l~   47 (243)
T TIGR01978        30 AIMGPNGSGKSTLSKTIA   47 (243)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 160
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=93.56  E-value=0.05  Score=39.48  Aligned_cols=18  Identities=33%  Similarity=0.429  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        28 ~i~G~nGsGKSTLl~~l~   45 (206)
T TIGR03608        28 AIIGESGSGKSTLLNIIG   45 (206)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999764


No 161
>TIGR00602 rad24 checkpoint protein rad24. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=93.56  E-value=0.075  Score=46.67  Aligned_cols=43  Identities=19%  Similarity=0.068  Sum_probs=33.7

Q ss_pred             CceeecchhHHHHHHHHhcCCC----CCc-ceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALND----VDT-VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~----~~~-~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+++|.++.++.+..+|.....    .++ -|+|..|.||||+++.+.
T Consensus        84 del~~~~~ki~~l~~~l~~~~~~~~~~~illL~GP~GsGKTTl~~~la  131 (637)
T TIGR00602        84 HELAVHKKKIEEVETWLKAQVLENAPKRILLITGPSGCGKSTTIKILS  131 (637)
T ss_pred             HHhcCcHHHHHHHHHHHHhcccccCCCcEEEEECCCCCCHHHHHHHHH
Confidence            5799999999998888864321    233 888999999999999764


No 162
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional
Probab=93.56  E-value=0.072  Score=44.72  Aligned_cols=43  Identities=16%  Similarity=0.134  Sum_probs=30.4

Q ss_pred             ceeecchhHHHHHHHHhc---CC---------C-CCcceEecCCCcHHHHHHhhhc
Q 046733           63 FAYGRDGDRNKIINRLSA---LN---------D-VDTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        63 ~vvGrd~~~~~lv~~L~~---~~---------~-~~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      ++.|.++.++.|.+.+..   ..         . ..+-++|..|.|||+||++|.+
T Consensus       184 DIgGl~~qi~~l~e~v~lpl~~p~~~~~~gi~~p~gVLL~GPPGTGKT~LAraIA~  239 (438)
T PTZ00361        184 DIGGLEQQIQEIKEAVELPLTHPELYDDIGIKPPKGVILYGPPGTGKTLLAKAVAN  239 (438)
T ss_pred             HhcCHHHHHHHHHHHHHhhhhCHHHHHhcCCCCCcEEEEECCCCCCHHHHHHHHHH
Confidence            577888888887766521   10         0 0126789999999999998753


No 163
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids.  The  E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.
Probab=93.55  E-value=0.048  Score=40.01  Aligned_cols=18  Identities=33%  Similarity=0.602  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~i~G~nGsGKSTLl~~l~   47 (222)
T cd03224          30 ALLGRNGAGKTTLLKTIM   47 (222)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999764


No 164
>TIGR00150 HI0065_YjeE ATPase, YjeE family. Members of this family have a conserved nucleotide-binding motif GXXGXGKT and a nucleotide-binding fold. Member protein YjeE of Haemophilus influenzae (HI0065) was shown to have ATPase activity.
Probab=93.53  E-value=0.11  Score=37.08  Aligned_cols=36  Identities=14%  Similarity=0.080  Sum_probs=24.6

Q ss_pred             hhHHHHHHHHhcCC-CCCc-ceEecCCCcHHHHHHhhh
Q 046733           69 GDRNKIINRLSALN-DVDT-VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        69 ~~~~~lv~~L~~~~-~~~~-~IvGmGGiGKTTLA~~Vy  104 (106)
                      ++...+.+.|...- ...+ .+.|.-|.|||||++.+.
T Consensus         6 ~~t~~l~~~l~~~l~~~~~i~l~G~lGaGKTtl~~~l~   43 (133)
T TIGR00150         6 KAMDKFGKAFAKPLDFGTVVLLKGDLGAGKTTLVQGLL   43 (133)
T ss_pred             HHHHHHHHHHHHhCCCCCEEEEEcCCCCCHHHHHHHHH
Confidence            44556666554321 2234 888999999999999764


No 165
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment.  ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=93.52  E-value=0.05  Score=40.75  Aligned_cols=18  Identities=39%  Similarity=0.556  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        31 ~i~G~nGsGKSTLl~~l~   48 (242)
T cd03295          31 VLIGPSGSGKTTTMKMIN   48 (242)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999875


No 166
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=93.50  E-value=0.047  Score=41.34  Aligned_cols=19  Identities=32%  Similarity=0.595  Sum_probs=17.7

Q ss_pred             ceEecCCCcHHHHHHhhhc
Q 046733           87 VIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy~  105 (106)
                      .|+|..|.|||||..++++
T Consensus        29 ~IvG~NGsGKStll~Ai~~   47 (251)
T cd03273          29 AITGLNGSGKSNILDAICF   47 (251)
T ss_pred             EEECCCCCCHHHHHHHHHH
Confidence            9999999999999999874


No 167
>COG3899 Predicted ATPase [General function prediction only]
Probab=93.50  E-value=0.072  Score=47.94  Aligned_cols=41  Identities=17%  Similarity=0.481  Sum_probs=33.1

Q ss_pred             eeecchhHHHHHHHHhcCCCC--Cc-ceEecCCCcHHHHHHhhh
Q 046733           64 AYGRDGDRNKIINRLSALNDV--DT-VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        64 vvGrd~~~~~lv~~L~~~~~~--~~-~IvGmGGiGKTTLA~~Vy  104 (106)
                      ++||+.+.+.|...+-+-...  .+ .++|..|||||+|++.|.
T Consensus         2 l~GRe~ev~~Ll~~f~~v~~g~~~~~lv~G~sGIGKsalv~ev~   45 (849)
T COG3899           2 LYGRETELAQLLAAFDRVSKGRGEVVLVAGESGIGKSALVNEVH   45 (849)
T ss_pred             CCchHhHHHHHHHHHHHHhCCCeEEEEEeecCCCcHHHHHHHHH
Confidence            689999999998877543322  34 899999999999999874


No 168
>PRK10536 hypothetical protein; Provisional
Probab=93.47  E-value=0.093  Score=41.66  Aligned_cols=40  Identities=13%  Similarity=0.139  Sum_probs=30.9

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~V  103 (106)
                      ..+.++......++..|.+..  -+.+.|..|.|||+||.++
T Consensus        55 ~~i~p~n~~Q~~~l~al~~~~--lV~i~G~aGTGKT~La~a~   94 (262)
T PRK10536         55 SPILARNEAQAHYLKAIESKQ--LIFATGEAGCGKTWISAAK   94 (262)
T ss_pred             ccccCCCHHHHHHHHHHhcCC--eEEEECCCCCCHHHHHHHH
Confidence            457788888888888776532  2388899999999999864


No 169
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]
Probab=93.43  E-value=0.053  Score=41.50  Aligned_cols=18  Identities=33%  Similarity=0.505  Sum_probs=15.6

Q ss_pred             ceE--ecCCCcHHHHHHhhh
Q 046733           87 VIV--GIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~Iv--GmGGiGKTTLA~~Vy  104 (106)
                      .||  |..|.||||+|.+++
T Consensus        25 viW~TGLSGsGKSTiA~ale   44 (197)
T COG0529          25 VIWFTGLSGSGKSTIANALE   44 (197)
T ss_pred             EEEeecCCCCCHHHHHHHHH
Confidence            455  999999999999875


No 170
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF. Members of this protein family are PspF, the sigma-54-dependent transcriptional activator of the phage shock protein (psp) operon, in Escherichia coli and numerous other species. The psp operon is induced by a number of stress conditions, including heat shock, ethanol, and filamentous phage infection. Changed com_name to adhere to TIGR role notes conventions. 09/15/06 - DMH
Probab=93.43  E-value=0.084  Score=42.29  Aligned_cols=42  Identities=19%  Similarity=0.371  Sum_probs=31.3

Q ss_pred             eeecchhHHHHHHHHhcCCCC--CcceEecCCCcHHHHHHhhhc
Q 046733           64 AYGRDGDRNKIINRLSALNDV--DTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        64 vvGrd~~~~~lv~~L~~~~~~--~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      ++|......++.+.+..-...  .+-|+|-.|.||+++|+.+++
T Consensus         1 liG~S~~m~~~~~~~~~~a~~~~pVLI~GE~GtGK~~lAr~iH~   44 (329)
T TIGR02974         1 LIGESNAFLEVLEQVSRLAPLDRPVLIIGERGTGKELIAARLHY   44 (329)
T ss_pred             CCcCCHHHHHHHHHHHHHhCCCCCEEEECCCCChHHHHHHHHHH
Confidence            467777777777776543333  348889999999999999875


No 171
>PRK06526 transposase; Provisional
Probab=93.42  E-value=0.053  Score=42.10  Aligned_cols=19  Identities=26%  Similarity=0.398  Sum_probs=16.8

Q ss_pred             CcceEecCCCcHHHHHHhh
Q 046733           85 DTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        85 ~~~IvGmGGiGKTTLA~~V  103 (106)
                      ++-++|..|.|||+||..+
T Consensus       100 nlll~Gp~GtGKThLa~al  118 (254)
T PRK06526        100 NVVFLGPPGTGKTHLAIGL  118 (254)
T ss_pred             eEEEEeCCCCchHHHHHHH
Confidence            3489999999999999975


No 172
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional
Probab=93.41  E-value=0.053  Score=40.53  Aligned_cols=18  Identities=28%  Similarity=0.516  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        32 ~i~G~nGsGKSTLl~~l~   49 (242)
T PRK11124         32 VLLGPSGAGKSSLLRVLN   49 (242)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 173
>PLN02200 adenylate kinase family protein
Probab=93.41  E-value=0.051  Score=41.56  Aligned_cols=17  Identities=29%  Similarity=0.370  Sum_probs=15.4

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      -|+|+.|.||||+|+.+
T Consensus        47 ~I~G~PGSGKsT~a~~L   63 (234)
T PLN02200         47 FVLGGPGSGKGTQCEKI   63 (234)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            78899999999999865


No 174
>TIGR00764 lon_rel lon-related putative ATP-dependent protease. Members of this family from Pyrococcus horikoshii and Pyrococcus abyssi each contain a predicted intein.
Probab=93.39  E-value=0.077  Score=46.07  Aligned_cols=41  Identities=17%  Similarity=0.281  Sum_probs=30.8

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+++|.++-++.+...+....  .+-++|+.|+||||||+.+-
T Consensus        18 ~~viG~~~a~~~l~~a~~~~~--~~ll~G~pG~GKT~la~~la   58 (608)
T TIGR00764        18 DQVIGQEEAVEIIKKAAKQKR--NVLLIGEPGVGKSMLAKAMA   58 (608)
T ss_pred             hhccCHHHHHHHHHHHHHcCC--CEEEECCCCCCHHHHHHHHH
Confidence            468899887776666554432  34788999999999999753


No 175
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids.  The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis.  YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein.  Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli.  The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=93.39  E-value=0.053  Score=40.13  Aligned_cols=18  Identities=28%  Similarity=0.418  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~l~G~nGsGKSTLl~~l~   47 (232)
T cd03218          30 GLLGPNGAGKTTTFYMIV   47 (232)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999864


No 176
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional
Probab=93.38  E-value=0.055  Score=40.27  Aligned_cols=18  Identities=33%  Similarity=0.477  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        37 ~i~G~nGsGKSTLl~~l~   54 (225)
T PRK10247         37 LITGPSGCGKSTLLKIVA   54 (225)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 177
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli.  The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane.  HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB.  This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport.  Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.
Probab=93.38  E-value=0.054  Score=40.29  Aligned_cols=18  Identities=44%  Similarity=0.409  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        32 ~i~G~nGsGKSTLl~~l~   49 (237)
T cd03252          32 GIVGRSGSGKSTLTKLIQ   49 (237)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999764


No 178
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional
Probab=93.37  E-value=0.096  Score=45.68  Aligned_cols=42  Identities=17%  Similarity=0.143  Sum_probs=33.0

Q ss_pred             CceeecchhHHHHHHHHhcCCCC-CcceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDV-DTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~-~~~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.++-+..|..++...+.. .+-++|..|+||||+|+.+
T Consensus        16 ~~liGq~~i~~~L~~~l~~~rl~~a~Lf~Gp~G~GKttlA~~l   58 (620)
T PRK14948         16 DELVGQEAIATTLKNALISNRIAPAYLFTGPRGTGKTSSARIL   58 (620)
T ss_pred             hhccChHHHHHHHHHHHHcCCCCceEEEECCCCCChHHHHHHH
Confidence            46899998888888888654432 2367899999999999875


No 179
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance.  Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis.  The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC.  Bacitracin has potent antibiotic activity against gram-positive bacteria.  The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin.  The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC.  B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.
Probab=93.37  E-value=0.056  Score=39.44  Aligned_cols=18  Identities=33%  Similarity=0.407  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~i~G~nGsGKSTLl~~l~   47 (208)
T cd03268          30 GFLGPNGAGKTTTMKIIL   47 (208)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 180
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional
Probab=93.35  E-value=0.054  Score=40.62  Aligned_cols=18  Identities=33%  Similarity=0.554  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        33 ~i~G~nGsGKSTLl~~l~   50 (250)
T PRK11264         33 AIIGPSGSGKTTLLRCIN   50 (250)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999763


No 181
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional
Probab=93.34  E-value=0.053  Score=40.78  Aligned_cols=18  Identities=22%  Similarity=0.379  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        33 ~i~G~nGsGKSTLl~~i~   50 (250)
T PRK14245         33 AFIGPSGCGKSTFLRLFN   50 (250)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999873


No 182
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=93.34  E-value=0.054  Score=40.72  Aligned_cols=18  Identities=28%  Similarity=0.571  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        35 ~l~G~nGsGKSTLl~~l~   52 (255)
T PRK11300         35 SLIGPNGAGKTTVFNCLT   52 (255)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 183
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL. Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se.
Probab=93.32  E-value=0.056  Score=39.84  Aligned_cols=18  Identities=33%  Similarity=0.658  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        38 ~l~G~nGsGKSTLl~~i~   55 (224)
T TIGR02324        38 ALSGPSGAGKSTLLKSLY   55 (224)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999875


No 184
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional
Probab=93.32  E-value=0.055  Score=41.27  Aligned_cols=18  Identities=33%  Similarity=0.514  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        31 ~i~G~nGsGKSTLl~~l~   48 (255)
T PRK11248         31 VVLGPSGCGKTTLLNLIA   48 (255)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 185
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein. This model represents the ATP-binding protein of a family of ABC transporters for inorganic phosphate. In the model species Escherichia coli, a constitutive transporter for inorganic phosphate, with low affinity, is also present. The high affinity transporter that includes this polypeptide is induced when extracellular phosphate concentrations are low. The proteins most similar to the members of this family but not included appear to be amino acid transporters.
Probab=93.28  E-value=0.055  Score=40.63  Aligned_cols=17  Identities=24%  Similarity=0.608  Sum_probs=16.1

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .|+|..|.|||||.+.+
T Consensus        31 ~i~G~nGsGKSTLl~~l   47 (247)
T TIGR00972        31 ALIGPSGCGKSTLLRSL   47 (247)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            99999999999999976


No 186
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed
Probab=93.27  E-value=0.056  Score=40.35  Aligned_cols=18  Identities=39%  Similarity=0.593  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        31 ~l~G~nGsGKSTLl~~l~   48 (240)
T PRK09493         31 VIIGPSGSGKSTLLRCIN   48 (240)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999763


No 187
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively.  Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP.  HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM.  The two HisP subunits form a homodimer within the complex.  The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems.  All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria.  The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM
Probab=93.26  E-value=0.058  Score=39.33  Aligned_cols=18  Identities=39%  Similarity=0.593  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~l~G~nGsGKSTLl~~l~   47 (213)
T cd03262          30 VIIGPSGSGKSTLLRCIN   47 (213)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 188
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.
Probab=93.24  E-value=0.079  Score=37.67  Aligned_cols=20  Identities=15%  Similarity=0.310  Sum_probs=17.4

Q ss_pred             CcceEecCCCcHHHHHHhhh
Q 046733           85 DTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        85 ~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      ++.|+|..|.|||||...+.
T Consensus        20 ~i~ivG~~~~GKStlin~l~   39 (179)
T TIGR03598        20 EIAFAGRSNVGKSSLINALT   39 (179)
T ss_pred             EEEEEcCCCCCHHHHHHHHh
Confidence            34999999999999998764


No 189
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein. This model describes the energy-transducing ATPase subunit ThiQ of the ThiBPQ thiamine (and thiamine pyrophosphate) ABC transporter in several Proteobacteria. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found.
Probab=93.22  E-value=0.06  Score=39.59  Aligned_cols=18  Identities=33%  Similarity=0.449  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.++
T Consensus        28 ~i~G~nGsGKSTLl~~l~   45 (213)
T TIGR01277        28 AIMGPSGAGKSTLLNLIA   45 (213)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999875


No 190
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional
Probab=93.21  E-value=0.058  Score=40.52  Aligned_cols=18  Identities=22%  Similarity=0.420  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        33 ~i~G~nGsGKSTLl~~i~   50 (250)
T PRK14247         33 ALMGPSGSGKSTLLRVFN   50 (250)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999864


No 191
>PRK14242 phosphate transporter ATP-binding protein; Provisional
Probab=93.20  E-value=0.06  Score=40.50  Aligned_cols=18  Identities=22%  Similarity=0.468  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        36 ~i~G~nGsGKSTLl~~l~   53 (253)
T PRK14242         36 ALIGPSGCGKSTFLRCLN   53 (253)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999999874


No 192
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional
Probab=93.20  E-value=0.058  Score=40.83  Aligned_cols=18  Identities=33%  Similarity=0.495  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        35 ~l~G~nGsGKSTLl~~i~   52 (257)
T PRK10619         35 SIIGSSGSGKSTFLRCIN   52 (257)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 193
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX). A member of the ATP-dependent proteases, ClpX has ATP-dependent chaperone activity and is required for specific ATP-dependent proteolytic activities expressed by ClpPX. The gene is also found to be involved in stress tolerance in Bacillus subtilis and is essential for the efficient acquisition of genes specifying type IA and IB restriction.
Probab=93.20  E-value=0.11  Score=43.43  Aligned_cols=43  Identities=12%  Similarity=0.321  Sum_probs=29.9

Q ss_pred             CceeecchhHHHHHHHHh-------c---CC--C------CCcceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLS-------A---LN--D------VDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~-------~---~~--~------~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      ..|+|.++.++.+..-+.       .   ..  .      .++-++|..|+|||+||+.+-
T Consensus        77 ~~ViGQe~A~~~l~~av~~h~~~~~~~~~~~~~~~~~~~~~~iLL~GP~GsGKT~lAraLA  137 (413)
T TIGR00382        77 EYVIGQEQAKKVLSVAVYNHYKRLNFEKNKKSDNGVELSKSNILLIGPTGSGKTLLAQTLA  137 (413)
T ss_pred             ceecCHHHHHHHHHHHHHHHHhhhccccccccccccccCCceEEEECCCCcCHHHHHHHHH
Confidence            479999988888754331       1   01  0      123677999999999999763


No 194
>PRK10908 cell division protein FtsE; Provisional
Probab=93.20  E-value=0.061  Score=39.70  Aligned_cols=18  Identities=33%  Similarity=0.481  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        32 ~i~G~nGsGKSTLl~~l~   49 (222)
T PRK10908         32 FLTGHSGAGKSTLLKLIC   49 (222)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999864


No 195
>PRK09183 transposase/IS protein; Provisional
Probab=93.18  E-value=0.06  Score=41.68  Aligned_cols=19  Identities=26%  Similarity=0.387  Sum_probs=16.9

Q ss_pred             cceEecCCCcHHHHHHhhh
Q 046733           86 TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +.|+|..|+|||+||..+.
T Consensus       105 v~l~Gp~GtGKThLa~al~  123 (259)
T PRK09183        105 IVLLGPSGVGKTHLAIALG  123 (259)
T ss_pred             EEEEeCCCCCHHHHHHHHH
Confidence            4899999999999999863


No 196
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional
Probab=93.17  E-value=0.1  Score=43.18  Aligned_cols=44  Identities=18%  Similarity=0.206  Sum_probs=30.9

Q ss_pred             CceeecchhHHHHHHHHh---cC-C---C------CCcceEecCCCcHHHHHHhhhc
Q 046733           62 KFAYGRDGDRNKIINRLS---AL-N---D------VDTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~---~~-~---~------~~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      .++.|.+..++.|.+.+.   .. .   .      ..+-++|..|.|||+||+.+.+
T Consensus       145 ~digGl~~~k~~l~~~v~~pl~~~~~~~~~Gl~~pkgvLL~GppGTGKT~LAkalA~  201 (398)
T PTZ00454        145 SDIGGLDIQKQEIREAVELPLTCPELYEQIGIDPPRGVLLYGPPGTGKTMLAKAVAH  201 (398)
T ss_pred             HHcCCHHHHHHHHHHHHHHHhcCHHHHHhcCCCCCceEEEECCCCCCHHHHHHHHHH
Confidence            368899888888876542   11 1   0      1237889999999999998753


No 197
>PRK05642 DNA replication initiation factor; Validated
Probab=93.12  E-value=0.059  Score=40.88  Aligned_cols=19  Identities=16%  Similarity=0.316  Sum_probs=16.9

Q ss_pred             ceEecCCCcHHHHHHhhhc
Q 046733           87 VIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy~  105 (106)
                      -|+|..|+|||.|++++.+
T Consensus        49 ~l~G~~G~GKTHLl~a~~~   67 (234)
T PRK05642         49 YLWGKDGVGRSHLLQAACL   67 (234)
T ss_pred             EEECCCCCCHHHHHHHHHH
Confidence            7889999999999998753


No 198
>PRK07133 DNA polymerase III subunits gamma and tau; Validated
Probab=93.12  E-value=0.1  Score=46.51  Aligned_cols=42  Identities=21%  Similarity=0.162  Sum_probs=33.1

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.+.-++.|.+.+...+.... =+.|..|+||||+|+.+
T Consensus        18 ~dIiGQe~~v~~L~~aI~~~rl~HAYLF~GP~GtGKTt~AriL   60 (725)
T PRK07133         18 DDIVGQDHIVQTLKNIIKSNKISHAYLFSGPRGTGKTSVAKIF   60 (725)
T ss_pred             HHhcCcHHHHHHHHHHHHcCCCCeEEEEECCCCCcHHHHHHHH
Confidence            4699999988888888866543332 57899999999999865


No 199
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional
Probab=93.10  E-value=0.063  Score=40.65  Aligned_cols=18  Identities=33%  Similarity=0.457  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        36 ~i~G~nGsGKSTLl~~l~   53 (258)
T PRK11701         36 GIVGESGSGKTTLLNALS   53 (258)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999875


No 200
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome.  The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation.  To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes.  X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family.  The disease is characterized by a striking and unpredictable variation in phenotypic expression.  Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt
Probab=93.09  E-value=0.066  Score=38.25  Aligned_cols=18  Identities=28%  Similarity=0.573  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        31 ~i~G~nGsGKSTLl~~l~   48 (166)
T cd03223          31 LITGPSGTGKSSLFRALA   48 (166)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 201
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1.  In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD.  MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.
Probab=93.09  E-value=0.067  Score=39.81  Aligned_cols=18  Identities=33%  Similarity=0.420  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        33 ~l~G~nGsGKSTLl~~i~   50 (238)
T cd03249          33 ALVGSSGCGKSTVVSLLE   50 (238)
T ss_pred             EEEeCCCCCHHHHHHHHh
Confidence            999999999999999864


No 202
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=93.08  E-value=0.062  Score=39.77  Aligned_cols=18  Identities=28%  Similarity=0.639  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~l~G~nGsGKSTLl~~l~   47 (230)
T TIGR03410        30 CVLGRNGVGKTTLLKTLM   47 (230)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 203
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional
Probab=93.07  E-value=0.064  Score=39.87  Aligned_cols=19  Identities=21%  Similarity=0.247  Sum_probs=17.0

Q ss_pred             cceEecCCCcHHHHHHhhh
Q 046733           86 TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +.|+|..|.|||||.+.+.
T Consensus        16 ~~l~G~NGsGKSTLlk~i~   34 (213)
T PRK15177         16 IGILAAPGSGKTTLTRLLC   34 (213)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            4799999999999999875


No 204
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis.  The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes.  CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space.  In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.
Probab=93.06  E-value=0.066  Score=38.38  Aligned_cols=18  Identities=22%  Similarity=0.414  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        32 ~i~G~nGsGKStLl~~l~   49 (178)
T cd03247          32 ALLGRSGSGKSTLLQLLT   49 (178)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999764


No 205
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.
Probab=93.06  E-value=0.063  Score=40.29  Aligned_cols=18  Identities=28%  Similarity=0.379  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        51 ~i~G~NGsGKSTLl~~i~   68 (236)
T cd03267          51 GFIGPNGAGKTTTLKILS   68 (236)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999864


No 206
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional
Probab=93.05  E-value=0.12  Score=44.84  Aligned_cols=44  Identities=18%  Similarity=0.280  Sum_probs=34.8

Q ss_pred             CceeecchhHHHHHHHHhcCCCC--CcceEecCCCcHHHHHHhhhc
Q 046733           62 KFAYGRDGDRNKIINRLSALNDV--DTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~--~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      ..++|.......+.+.+..-...  .+-|+|-.|.|||++|+.+++
T Consensus       376 ~~liG~S~~~~~~~~~~~~~a~~~~pVLI~GE~GTGK~~lA~~ih~  421 (686)
T PRK15429        376 GEIIGRSEAMYSVLKQVEMVAQSDSTVLILGETGTGKELIARAIHN  421 (686)
T ss_pred             cceeecCHHHHHHHHHHHHHhCCCCCEEEECCCCcCHHHHHHHHHH
Confidence            46999998888888777543222  458889999999999999875


No 207
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional
Probab=93.05  E-value=0.066  Score=39.32  Aligned_cols=18  Identities=33%  Similarity=0.499  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        32 ~i~G~nGsGKSTLl~~l~   49 (207)
T PRK13539         32 VLTGPNGSGKTTLLRLIA   49 (207)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 208
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional
Probab=93.05  E-value=0.065  Score=39.10  Aligned_cols=18  Identities=33%  Similarity=0.409  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        31 ~l~G~nGsGKSTLl~~i~   48 (200)
T PRK13540         31 HLKGSNGAGKTTLLKLIA   48 (200)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999764


No 209
>CHL00131 ycf16 sulfate ABC transporter protein; Validated
Probab=93.05  E-value=0.063  Score=40.28  Aligned_cols=18  Identities=39%  Similarity=0.444  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+-
T Consensus        37 ~i~G~nGsGKSTLl~~i~   54 (252)
T CHL00131         37 AIMGPNGSGKSTLSKVIA   54 (252)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            999999999999999763


No 210
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional
Probab=93.04  E-value=0.063  Score=40.68  Aligned_cols=18  Identities=33%  Similarity=0.521  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        42 ~l~G~nGsGKSTLl~~l~   59 (259)
T PRK14274         42 AIIGPSGCGKSTFIKTLN   59 (259)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999999864


No 211
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=93.03  E-value=0.065  Score=39.69  Aligned_cols=18  Identities=33%  Similarity=0.392  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        32 ~i~G~nGsGKSTLl~~l~   49 (234)
T cd03251          32 ALVGPSGSGKSTLVNLIP   49 (234)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999764


No 212
>TIGR00750 lao LAO/AO transport system ATPase. Mutations have also been found that do not phosphorylate the periplasmic binding proteins, yet still allow transport. The ATPase activity of this protein seems to be necessary, however.
Probab=93.03  E-value=0.11  Score=40.72  Aligned_cols=33  Identities=18%  Similarity=0.383  Sum_probs=21.5

Q ss_pred             HHHHHHHHhcCCCC-Cc-ceEecCCCcHHHHHHhh
Q 046733           71 RNKIINRLSALNDV-DT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        71 ~~~lv~~L~~~~~~-~~-~IvGmGGiGKTTLA~~V  103 (106)
                      ...+++.+...... .+ .|+|.+|.|||||+..+
T Consensus        20 ~~~~~~~~~~~~~~~~~i~i~G~~G~GKttl~~~l   54 (300)
T TIGR00750        20 AKQLLDRIMPYTGNAHRVGITGTPGAGKSTLLEAL   54 (300)
T ss_pred             HHHHHHhCCcccCCceEEEEECCCCCCHHHHHHHH
Confidence            44455544322222 23 88999999999998864


No 213
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional
Probab=93.02  E-value=0.064  Score=40.05  Aligned_cols=17  Identities=24%  Similarity=0.446  Sum_probs=16.0

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .|+|..|.|||||.+.+
T Consensus        33 ~l~G~nGsGKSTLl~~l   49 (241)
T PRK10895         33 GLLGPNGAGKTTTFYMV   49 (241)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            99999999999999976


No 214
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional
Probab=93.01  E-value=0.066  Score=40.21  Aligned_cols=18  Identities=44%  Similarity=0.519  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        33 ~i~G~nGsGKSTLl~~l~   50 (241)
T PRK14250         33 TIVGPSGAGKSTLIKLIN   50 (241)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 215
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA. This model describes the cyt c biogenesis protein encoded by ccmA in bacteria. An exception is, an arabidopsis protein. Quite likely this is encoded by an organelle. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.
Probab=93.00  E-value=0.067  Score=38.90  Aligned_cols=18  Identities=22%  Similarity=0.486  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~i~G~nGsGKSTLl~~l~   47 (198)
T TIGR01189        30 QVTGPNGIGKTTLLRILA   47 (198)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999764


No 216
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains.  The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence.  This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.
Probab=92.98  E-value=0.064  Score=39.83  Aligned_cols=18  Identities=33%  Similarity=0.590  Sum_probs=17.0

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||..+++
T Consensus        26 ~i~G~NGsGKTTLl~ai~   43 (204)
T cd03240          26 LIVGQNGAGKTTIIEALK   43 (204)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            899999999999999985


No 217
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=92.98  E-value=0.063  Score=39.51  Aligned_cols=18  Identities=39%  Similarity=0.399  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        29 ~l~G~nGsGKSTLl~~l~   46 (177)
T cd03222          29 GIVGPNGTGKTTAVKILA   46 (177)
T ss_pred             EEECCCCChHHHHHHHHH
Confidence            999999999999999764


No 218
>PRK14239 phosphate transporter ATP-binding protein; Provisional
Probab=92.97  E-value=0.067  Score=40.12  Aligned_cols=18  Identities=28%  Similarity=0.560  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        35 ~i~G~nGsGKSTLl~~l~   52 (252)
T PRK14239         35 ALIGPSGSGKSTLLRSIN   52 (252)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999874


No 219
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA.
Probab=92.95  E-value=0.14  Score=45.14  Aligned_cols=43  Identities=16%  Similarity=0.299  Sum_probs=32.7

Q ss_pred             CceeecchhHHHHHHHHhcCC-----CC---C-cceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALN-----DV---D-TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~-----~~---~-~~IvGmGGiGKTTLA~~Vy  104 (106)
                      ..|+|.++.++.|.+.+....     ..   . +-.+|..|+|||+||+.+.
T Consensus       454 ~~v~GQ~~ai~~l~~~i~~~~~g~~~~~~p~~~~lf~Gp~GvGKT~lA~~la  505 (731)
T TIGR02639       454 AKIFGQDEAIDSLVSSIKRSRAGLGNPNKPVGSFLFTGPTGVGKTELAKQLA  505 (731)
T ss_pred             cceeCcHHHHHHHHHHHHHHhcCCCCCCCCceeEEEECCCCccHHHHHHHHH
Confidence            579999999999988775321     11   1 1677999999999999864


No 220
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=92.95  E-value=0.065  Score=40.94  Aligned_cols=18  Identities=33%  Similarity=0.471  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        29 ~i~G~NGsGKSTLlk~L~   46 (246)
T cd03237          29 GILGPNGIGKTTFIKMLA   46 (246)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 221
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]
Probab=92.95  E-value=0.081  Score=46.68  Aligned_cols=42  Identities=21%  Similarity=0.348  Sum_probs=31.4

Q ss_pred             Cceeecch---hHHHHHHHHhcCCCC---------CcceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDG---DRNKIINRLSALNDV---------DTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~---~~~~lv~~L~~~~~~---------~~~IvGmGGiGKTTLA~~V  103 (106)
                      ++|-|-|+   +.++|++.|.++..-         .+-+||..|.|||-||++|
T Consensus       304 ~dVkG~DEAK~ELeEiVefLkdP~kftrLGGKLPKGVLLvGPPGTGKTlLARAv  357 (752)
T KOG0734|consen  304 EDVKGVDEAKQELEEIVEFLKDPTKFTRLGGKLPKGVLLVGPPGTGKTLLARAV  357 (752)
T ss_pred             ccccChHHHHHHHHHHHHHhcCcHHhhhccCcCCCceEEeCCCCCchhHHHHHh
Confidence            46778874   556678888765421         2377899999999999986


No 222
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=92.94  E-value=0.069  Score=39.77  Aligned_cols=18  Identities=39%  Similarity=0.556  Sum_probs=17.1

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.++++
T Consensus        27 ~i~GpNGsGKStll~ai~   44 (243)
T cd03272          27 VVVGRNGSGKSNFFAAIR   44 (243)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            899999999999999986


No 223
>PRK14241 phosphate transporter ATP-binding protein; Provisional
Probab=92.94  E-value=0.067  Score=40.52  Aligned_cols=18  Identities=28%  Similarity=0.538  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        34 ~i~G~nGsGKSTLl~~la   51 (258)
T PRK14241         34 AFIGPSGCGKSTVLRTLN   51 (258)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999764


No 224
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional
Probab=92.93  E-value=0.066  Score=41.01  Aligned_cols=18  Identities=33%  Similarity=0.547  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        37 ~i~G~nGsGKSTLl~~l~   54 (269)
T PRK11831         37 AIMGPSGIGKTTLLRLIG   54 (269)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 225
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional
Probab=92.92  E-value=0.067  Score=40.23  Aligned_cols=18  Identities=22%  Similarity=0.481  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        34 ~l~G~nGsGKSTLl~~l~   51 (253)
T PRK14267         34 ALMGPSGCGKSTLLRTFN   51 (253)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 226
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=92.91  E-value=0.07  Score=38.44  Aligned_cols=18  Identities=22%  Similarity=0.429  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~i~G~nGsGKSTLl~~l~   47 (182)
T cd03215          30 GIAGLVGNGQTELAEALF   47 (182)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999864


No 227
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional
Probab=92.90  E-value=0.068  Score=40.79  Aligned_cols=18  Identities=28%  Similarity=0.540  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        51 ~i~G~nGsGKSTLl~~l~   68 (268)
T PRK14248         51 ALIGPSGCGKSTFLRSIN   68 (268)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999999863


No 228
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed
Probab=92.87  E-value=0.071  Score=40.74  Aligned_cols=18  Identities=22%  Similarity=0.468  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        34 ~I~G~NGsGKSTLl~~i~   51 (251)
T PRK09544         34 TLLGPNGAGKSTLVRVVL   51 (251)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999875


No 229
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit. The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex.
Probab=92.87  E-value=0.071  Score=44.32  Aligned_cols=19  Identities=26%  Similarity=0.359  Sum_probs=17.2

Q ss_pred             cceEecCCCcHHHHHHhhh
Q 046733           86 TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +.|||..|.|||||++.+.
T Consensus       364 vaIvG~SGsGKSTLl~lL~  382 (529)
T TIGR02868       364 VAILGPSGSGKSTLLMLLT  382 (529)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            4999999999999999874


No 230
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional
Probab=92.87  E-value=0.068  Score=40.80  Aligned_cols=18  Identities=28%  Similarity=0.387  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        41 ~i~G~nGsGKSTLl~~l~   58 (265)
T PRK10575         41 GLIGHNGSGKSTLLKMLG   58 (265)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            999999999999999864


No 231
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea.  Only very few species lack representatives of the siderophore family transporters.  The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake.  The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA.  The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme.  A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.
Probab=92.86  E-value=0.075  Score=38.22  Aligned_cols=18  Identities=33%  Similarity=0.477  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        29 ~l~G~nGsGKStLl~~i~   46 (180)
T cd03214          29 GILGPNGAGKSTLLKTLA   46 (180)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999864


No 232
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]
Probab=92.86  E-value=0.13  Score=41.53  Aligned_cols=41  Identities=17%  Similarity=0.112  Sum_probs=29.4

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKN  102 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~  102 (106)
                      .++||-++.++++--...+.+.-++-|-||+|+||||-+..
T Consensus        27 ~dIVGNe~tv~rl~via~~gnmP~liisGpPG~GKTTsi~~   67 (333)
T KOG0991|consen   27 QDIVGNEDTVERLSVIAKEGNMPNLIISGPPGTGKTTSILC   67 (333)
T ss_pred             HHhhCCHHHHHHHHHHHHcCCCCceEeeCCCCCchhhHHHH
Confidence            47999998887765544443333447889999999996654


No 233
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional
Probab=92.84  E-value=0.07  Score=40.54  Aligned_cols=18  Identities=22%  Similarity=0.475  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        43 ~i~G~nGsGKSTLl~~l~   60 (260)
T PRK10744         43 AFIGPSGCGKSTLLRTFN   60 (260)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999863


No 234
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional
Probab=92.83  E-value=0.072  Score=40.34  Aligned_cols=18  Identities=28%  Similarity=0.383  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        33 ~l~G~nGsGKSTLl~~l~   50 (254)
T PRK10418         33 ALVGGSGSGKSLTCAAAL   50 (254)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999864


No 235
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein. This small clade of ABC-type transporter ATP-binding protein components is found as a three gene cassette along with a periplasmic substrate-binding protein (TIGR03868) and a permease (TIGR03869). The organisms containing this cassette are all Actinobacteria and all contain numerous genes requiring the coenzyme F420. This model was defined based on five such organisms, four of which are lacking all F420 biosynthetic capability save the final side-chain polyglutamate attachment step (via the gene cofE: TIGR01916). In Jonesia denitrificans DSM 20603 and marine actinobacterium PHSC20C1 this cassette is in an apparent operon with the cofE gene and, in PHSC20C1, also with a F420-dependent glucose-6-phosphate dehydrogenase (TIGR03554). Based on these observations we propose that this ATP-binding protein is a component of an F420-0 (that is, F420 lacking only the polyglutamate tail) transporter.
Probab=92.81  E-value=0.071  Score=40.33  Aligned_cols=18  Identities=22%  Similarity=0.364  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        31 ~i~G~nGsGKSTLl~~i~   48 (256)
T TIGR03873        31 GLLGPNGSGKSTLLRLLA   48 (256)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            899999999999999863


No 236
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain.  They export degradative enzymes by using a type I protein secretion system and  lack an N-terminal signal peptide, but contain a C-terminal secretion signal.  The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP).  For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli.  The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior.  HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels.  The spectrum of transport substra
Probab=92.81  E-value=0.075  Score=37.99  Aligned_cols=18  Identities=33%  Similarity=0.482  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        32 ~i~G~nGsGKStLl~~l~   49 (173)
T cd03246          32 AIIGPSGSGKSTLARLIL   49 (173)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            899999999999999764


No 237
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity.  In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins.  Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family.  The ATP-binding domain shows the highest similarity between all members of the ABC transporter family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=92.80  E-value=0.075  Score=37.99  Aligned_cols=18  Identities=33%  Similarity=0.458  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~i~G~nGsGKStLl~~l~   47 (173)
T cd03230          30 GLLGPNGAGKTTLIKIIL   47 (173)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999764


No 238
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional
Probab=92.80  E-value=0.069  Score=44.13  Aligned_cols=18  Identities=22%  Similarity=0.278  Sum_probs=16.3

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus       223 vI~G~~gsGKTTL~~~La  240 (399)
T PRK08099        223 AILGGESSGKSTLVNKLA  240 (399)
T ss_pred             EEEcCCCCCHHHHHHHHH
Confidence            899999999999999753


No 239
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional
Probab=92.79  E-value=0.072  Score=40.12  Aligned_cols=18  Identities=39%  Similarity=0.623  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        34 ~i~G~nGsGKSTLl~~l~   51 (252)
T PRK14256         34 AIIGPSGCGKSTVLRSIN   51 (252)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999999863


No 240
>PRK14238 phosphate transporter ATP-binding protein; Provisional
Probab=92.79  E-value=0.071  Score=40.94  Aligned_cols=18  Identities=33%  Similarity=0.499  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        54 ~I~G~nGsGKSTLl~~i~   71 (271)
T PRK14238         54 AIIGPSGCGKSTYIKTLN   71 (271)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999999864


No 241
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters.  PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=92.78  E-value=0.072  Score=39.13  Aligned_cols=18  Identities=22%  Similarity=0.379  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        37 ~i~G~nGsGKSTLl~~l~   54 (202)
T cd03233          37 LVLGRPGSGCSTLLKALA   54 (202)
T ss_pred             EEECCCCCCHHHHHHHhc
Confidence            999999999999999763


No 242
>PF13604 AAA_30:  AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A.
Probab=92.78  E-value=0.18  Score=37.24  Aligned_cols=32  Identities=19%  Similarity=0.295  Sum_probs=21.0

Q ss_pred             HHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhhh
Q 046733           72 NKIINRLSALNDVDT-VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        72 ~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+.+..++... .++ .|.|.+|.||||+.+.+.
T Consensus         7 ~~a~~~~l~~~-~~~~~l~G~aGtGKT~~l~~~~   39 (196)
T PF13604_consen    7 REAVRAILTSG-DRVSVLQGPAGTGKTTLLKALA   39 (196)
T ss_dssp             HHHHHHHHHCT-CSEEEEEESTTSTHHHHHHHHH
T ss_pred             HHHHHHHHhcC-CeEEEEEECCCCCHHHHHHHHH
Confidence            34444443322 234 677999999999998753


No 243
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional
Probab=92.77  E-value=0.073  Score=40.11  Aligned_cols=18  Identities=22%  Similarity=0.466  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        36 ~i~G~nGsGKSTLl~~l~   53 (253)
T PRK14261         36 ALIGPSGCGKSTLLRCFN   53 (253)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999874


No 244
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=92.76  E-value=0.071  Score=42.07  Aligned_cols=17  Identities=35%  Similarity=0.554  Sum_probs=15.9

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      +|+|..|+|||||-+.|
T Consensus        33 silGpSGcGKSTLLrii   49 (248)
T COG1116          33 AILGPSGCGKSTLLRLI   49 (248)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            99999999999998875


No 245
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=92.75  E-value=0.072  Score=40.76  Aligned_cols=18  Identities=33%  Similarity=0.573  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        31 ~i~G~nGsGKSTLl~~l~   48 (271)
T PRK13638         31 GLVGANGCGKSTLFMNLS   48 (271)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            999999999999999864


No 246
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=92.74  E-value=0.074  Score=40.83  Aligned_cols=18  Identities=22%  Similarity=0.409  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        37 ~l~G~nGsGKSTLl~~i~   54 (280)
T PRK13649         37 AFIGHTGSGKSTIMQLLN   54 (280)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999864


No 247
>cd03290 ABCC_SUR1_N The SUR domain 1.  The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=92.74  E-value=0.077  Score=39.04  Aligned_cols=18  Identities=39%  Similarity=0.468  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.++
T Consensus        31 ~i~G~nGsGKSTLl~~i~   48 (218)
T cd03290          31 MIVGQVGCGKSSLLLAIL   48 (218)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999875


No 248
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional
Probab=92.73  E-value=0.074  Score=39.92  Aligned_cols=18  Identities=33%  Similarity=0.615  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        33 ~i~G~nGsGKSTLl~~i~   50 (250)
T PRK14262         33 AIIGPSGCGKTTLLRSIN   50 (250)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999874


No 249
>cd03221 ABCF_EF-3 ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site.  The reaction requires ATP hydrolysis.  EF-3 contains two ATP nucleotide binding sequence (NBS) motifs.  NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=92.73  E-value=0.079  Score=37.14  Aligned_cols=18  Identities=39%  Similarity=0.446  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~i~G~nGsGKStLl~~l~   47 (144)
T cd03221          30 GLVGRNGAGKSTLLKLIA   47 (144)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            899999999999999764


No 250
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional
Probab=92.73  E-value=0.072  Score=42.40  Aligned_cols=18  Identities=39%  Similarity=0.508  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        37 ~ivG~sGsGKSTLl~~i~   54 (330)
T PRK15093         37 GLVGESGSGKSLIAKAIC   54 (330)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999999874


No 251
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed
Probab=92.73  E-value=0.074  Score=39.72  Aligned_cols=18  Identities=28%  Similarity=0.405  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        31 ~i~G~nGsGKSTLl~~l~   48 (248)
T PRK09580         31 AIMGPNGSGKSTLSATLA   48 (248)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            999999999999999864


No 252
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional
Probab=92.72  E-value=0.075  Score=39.96  Aligned_cols=18  Identities=22%  Similarity=0.488  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        35 ~l~G~nGsGKSTLl~~l~   52 (252)
T PRK14255         35 ALIGPSGCGKSTYLRTLN   52 (252)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999873


No 253
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional
Probab=92.72  E-value=0.15  Score=45.54  Aligned_cols=42  Identities=17%  Similarity=0.304  Sum_probs=31.6

Q ss_pred             CceeecchhHHHHHHHHhcCC----C-C----CcceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALN----D-V----DTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~----~-~----~~~IvGmGGiGKTTLA~~V  103 (106)
                      ..|+|.++.++.|.+.+....    . .    .+-++|..|+|||+||+.+
T Consensus       458 ~~ViGQ~~ai~~l~~~i~~~~~gl~~~~kp~~~~Lf~GP~GvGKT~lAk~L  508 (758)
T PRK11034        458 MLVFGQDKAIEALTEAIKMSRAGLGHEHKPVGSFLFAGPTGVGKTEVTVQL  508 (758)
T ss_pred             ceEeCcHHHHHHHHHHHHHHhccccCCCCCcceEEEECCCCCCHHHHHHHH
Confidence            468999999999988875321    1 1    1256799999999999865


No 254
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]
Probab=92.72  E-value=0.11  Score=46.98  Aligned_cols=42  Identities=24%  Similarity=0.355  Sum_probs=33.3

Q ss_pred             CceeecchhHHHHHHHHhcC----CC-CCc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSAL----ND-VDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~----~~-~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .+-.|.++-+++|++.|.-.    .. ..+ ..+|..|+|||.+|+.|
T Consensus       411 eDHYgm~dVKeRILEfiAV~kLrgs~qGkIlCf~GPPGVGKTSI~kSI  458 (906)
T KOG2004|consen  411 EDHYGMEDVKERILEFIAVGKLRGSVQGKILCFVGPPGVGKTSIAKSI  458 (906)
T ss_pred             ccccchHHHHHHHHHHHHHHhhcccCCCcEEEEeCCCCCCcccHHHHH
Confidence            47889999999999998422    11 234 78899999999999986


No 255
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.
Probab=92.71  E-value=0.071  Score=39.50  Aligned_cols=18  Identities=33%  Similarity=0.497  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+++.
T Consensus        32 ~i~G~NGsGKSTll~~i~   49 (213)
T cd03279          32 LICGPTGAGKSTILDAIT   49 (213)
T ss_pred             EEECCCCCCHHHHHHHhe
Confidence            999999999999999864


No 256
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional
Probab=92.70  E-value=0.075  Score=40.87  Aligned_cols=18  Identities=28%  Similarity=0.477  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        42 ~I~G~NGsGKSTLlk~l~   59 (257)
T PRK11247         42 AVVGRSGCGKSTLLRLLA   59 (257)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 257
>CHL00176 ftsH cell division protein; Validated
Probab=92.68  E-value=0.086  Score=46.16  Aligned_cols=43  Identities=21%  Similarity=0.258  Sum_probs=29.3

Q ss_pred             CceeecchhHHHHHHH---HhcCCC---------CCcceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINR---LSALND---------VDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~---L~~~~~---------~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .++.|.++.++.+.+.   |.....         ..+-++|..|.|||+||+.+.
T Consensus       183 ~dv~G~~~~k~~l~eiv~~lk~~~~~~~~g~~~p~gVLL~GPpGTGKT~LAralA  237 (638)
T CHL00176        183 RDIAGIEEAKEEFEEVVSFLKKPERFTAVGAKIPKGVLLVGPPGTGKTLLAKAIA  237 (638)
T ss_pred             HhccChHHHHHHHHHHHHHHhCHHHHhhccCCCCceEEEECCCCCCHHHHHHHHH
Confidence            4688988766666444   332211         023778999999999999874


No 258
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2.  A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.
Probab=92.68  E-value=0.078  Score=38.89  Aligned_cols=18  Identities=33%  Similarity=0.418  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        34 ~i~G~nGsGKSTLl~~i~   51 (220)
T cd03245          34 AIIGRVGSGKSTLLKLLA   51 (220)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 259
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea.  This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily.  The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=92.67  E-value=0.078  Score=40.70  Aligned_cols=18  Identities=39%  Similarity=0.665  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        54 ~l~G~nGsGKSTLl~~L~   71 (269)
T cd03294          54 VIMGLSGSGKSTLLRCIN   71 (269)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 260
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional
Probab=92.66  E-value=0.079  Score=40.21  Aligned_cols=18  Identities=33%  Similarity=0.521  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        37 ~l~G~nGsGKSTLlk~l~   54 (259)
T PRK14260         37 AIIGPSGCGKSTFIKTLN   54 (259)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999999874


No 261
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt   The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export.  Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters.  A typical system is made of a conserved integral membrane and an ABC.  In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.
Probab=92.65  E-value=0.078  Score=39.57  Aligned_cols=18  Identities=22%  Similarity=0.409  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        52 ~i~G~nGsGKSTLl~~l~   69 (224)
T cd03220          52 GLIGRNGAGKSTLLRLLA   69 (224)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999764


No 262
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional
Probab=92.65  E-value=0.077  Score=40.11  Aligned_cols=18  Identities=28%  Similarity=0.460  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        32 ~l~G~nGsGKSTLl~~l~   49 (255)
T PRK11231         32 ALIGPNGCGKSTLLKCFA   49 (255)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 263
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules.  Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells.  Subsequently, virus-infected or malignantly transformed cells can be eliminated.  TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.
Probab=92.65  E-value=0.082  Score=39.03  Aligned_cols=18  Identities=33%  Similarity=0.385  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        44 ~i~G~nGsGKSTLl~~l~   61 (226)
T cd03248          44 ALVGPSGSGKSTVVALLE   61 (226)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 264
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=92.64  E-value=0.082  Score=38.48  Aligned_cols=18  Identities=22%  Similarity=0.434  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        37 ~l~G~nGsGKSTLl~~l~   54 (192)
T cd03232          37 ALMGESGAGKTTLLDVLA   54 (192)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999864


No 265
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional
Probab=92.64  E-value=0.073  Score=42.39  Aligned_cols=18  Identities=44%  Similarity=0.397  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        37 ~lvG~sGsGKSTL~~~l~   54 (326)
T PRK11022         37 GIVGESGSGKSVSSLAIM   54 (326)
T ss_pred             EEECCCCChHHHHHHHHH
Confidence            999999999999999864


No 266
>PF13086 AAA_11:  AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A.
Probab=92.63  E-value=0.087  Score=37.57  Aligned_cols=16  Identities=31%  Similarity=0.439  Sum_probs=12.3

Q ss_pred             ceEecCCCcHHHHHHh
Q 046733           87 VIVGIGGLGKIVVWKN  102 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~  102 (106)
                      -|.|..|.||||+...
T Consensus        21 ~i~GpPGTGKT~~l~~   36 (236)
T PF13086_consen   21 LIQGPPGTGKTTTLAS   36 (236)
T ss_dssp             EEE-STTSSHHHHHHH
T ss_pred             EEECCCCCChHHHHHH
Confidence            8899999999975543


No 267
>PRK14237 phosphate transporter ATP-binding protein; Provisional
Probab=92.61  E-value=0.081  Score=40.49  Aligned_cols=18  Identities=22%  Similarity=0.484  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        50 ~I~G~nGsGKSTLl~~l~   67 (267)
T PRK14237         50 ALIGPSGSGKSTYLRSLN   67 (267)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999999875


No 268
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=92.61  E-value=0.081  Score=38.91  Aligned_cols=18  Identities=28%  Similarity=0.473  Sum_probs=16.4

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        25 ~l~G~nG~GKSTLl~~il   42 (176)
T cd03238          25 VVTGVSGSGKSTLVNEGL   42 (176)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999998763


No 269
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]
Probab=92.61  E-value=0.079  Score=42.21  Aligned_cols=17  Identities=35%  Similarity=0.429  Sum_probs=16.2

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .|||-.|.|||||++.+
T Consensus        43 glVGESG~GKSTlgr~i   59 (268)
T COG4608          43 GLVGESGCGKSTLGRLI   59 (268)
T ss_pred             EEEecCCCCHHHHHHHH
Confidence            99999999999999976


No 270
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria.  Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=92.61  E-value=0.083  Score=39.16  Aligned_cols=18  Identities=33%  Similarity=0.637  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        31 ~l~G~nGsGKSTLl~~i~   48 (236)
T cd03253          31 AIVGPSGSGKSTILRLLF   48 (236)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 271
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional
Probab=92.59  E-value=0.08  Score=40.61  Aligned_cols=18  Identities=28%  Similarity=0.578  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        43 ~l~G~nGsGKSTLl~~l~   60 (269)
T PRK14259         43 ALIGPSGCGKSTVLRSLN   60 (269)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999874


No 272
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=92.59  E-value=0.082  Score=38.82  Aligned_cols=18  Identities=33%  Similarity=0.470  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        34 ~i~G~nGsGKSTLl~~l~   51 (221)
T cd03244          34 GIVGRTGSGKSSLLLALF   51 (221)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999999763


No 273
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]
Probab=92.57  E-value=0.085  Score=41.69  Aligned_cols=19  Identities=32%  Similarity=0.326  Sum_probs=17.2

Q ss_pred             ceEecCCCcHHHHHHhhhc
Q 046733           87 VIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy~  105 (106)
                      .|+|..|.|||||-+.+..
T Consensus        32 ~iiGpNG~GKSTLLk~l~g   50 (258)
T COG1120          32 GILGPNGSGKSTLLKCLAG   50 (258)
T ss_pred             EEECCCCCCHHHHHHHHhc
Confidence            9999999999999998753


No 274
>TIGR00767 rho transcription termination factor Rho. Members of this family differ in the specificity of RNA binding.
Probab=92.57  E-value=0.069  Score=44.89  Aligned_cols=19  Identities=32%  Similarity=0.323  Sum_probs=17.8

Q ss_pred             ceEecCCCcHHHHHHhhhc
Q 046733           87 VIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy~  105 (106)
                      .|||.+|.|||||++.++.
T Consensus       172 ~IvG~~g~GKTtL~~~i~~  190 (415)
T TIGR00767       172 LIVAPPKAGKTVLLQKIAQ  190 (415)
T ss_pred             EEECCCCCChhHHHHHHHH
Confidence            8999999999999999875


No 275
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export.  They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins.  The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities.  The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=92.56  E-value=0.088  Score=37.55  Aligned_cols=18  Identities=39%  Similarity=0.529  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        32 ~l~G~nGsGKstLl~~i~   49 (171)
T cd03228          32 AIVGPSGSGKSTLLKLLL   49 (171)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999999874


No 276
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB. The TrbB protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbB is a homolog of the vir system VirB11 ATPase, and the Flp pilus sytem ATPase TadA.
Probab=92.56  E-value=0.073  Score=42.21  Aligned_cols=21  Identities=24%  Similarity=0.358  Sum_probs=17.8

Q ss_pred             CcceEecCCCcHHHHHHhhhc
Q 046733           85 DTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        85 ~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      ++-|.|..|.|||||++++..
T Consensus       134 ~ilI~G~tGSGKTTll~al~~  154 (299)
T TIGR02782       134 NILVVGGTGSGKTTLANALLA  154 (299)
T ss_pred             eEEEECCCCCCHHHHHHHHHH
Confidence            348889999999999998753


No 277
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional
Probab=92.55  E-value=0.16  Score=42.73  Aligned_cols=44  Identities=18%  Similarity=0.277  Sum_probs=35.5

Q ss_pred             CceeecchhHHHHHHHHhcCCCC--CcceEecCCCcHHHHHHhhhc
Q 046733           62 KFAYGRDGDRNKIINRLSALNDV--DTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~--~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      ..++|.....+++.+.+..-...  .+-|.|-.|+||+++|+.++.
T Consensus       187 ~~iig~s~~~~~~~~~i~~~a~~~~pVlI~Ge~GtGK~~~A~~ih~  232 (509)
T PRK05022        187 GEMIGQSPAMQQLKKEIEVVAASDLNVLILGETGVGKELVARAIHA  232 (509)
T ss_pred             CceeecCHHHHHHHHHHHHHhCCCCcEEEECCCCccHHHHHHHHHH
Confidence            46999999998888887653333  347889999999999999875


No 278
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors.  The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan.  The pigment precursors are encoded by the white, brown, and scarlet genes, respectively.  Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan.  However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes.  Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in 
Probab=92.55  E-value=0.081  Score=39.20  Aligned_cols=18  Identities=33%  Similarity=0.523  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        37 ~l~G~nGsGKSTLlk~l~   54 (226)
T cd03234          37 AILGSSGSGKTTLLDAIS   54 (226)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999864


No 279
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional
Probab=92.54  E-value=0.083  Score=40.72  Aligned_cols=18  Identities=22%  Similarity=0.433  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        50 ~IiG~nGsGKSTLl~~l~   67 (274)
T PRK14265         50 AFIGPSGCGKSTLLRCFN   67 (274)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999875


No 280
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins.
Probab=92.50  E-value=0.083  Score=39.80  Aligned_cols=18  Identities=22%  Similarity=0.516  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~i~G~nGsGKSTLl~~l~   47 (252)
T TIGR03005        30 ALIGPSGSGKSTILRILM   47 (252)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 281
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional
Probab=92.50  E-value=0.083  Score=39.31  Aligned_cols=18  Identities=33%  Similarity=0.453  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        29 ~l~G~nGsGKSTLl~~l~   46 (232)
T PRK10771         29 AILGPSGAGKSTLLNLIA   46 (232)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999763


No 282
>PRK14240 phosphate transporter ATP-binding protein; Provisional
Probab=92.49  E-value=0.084  Score=39.65  Aligned_cols=18  Identities=22%  Similarity=0.510  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        33 ~i~G~nGsGKSTLl~~i~   50 (250)
T PRK14240         33 ALIGPSGCGKSTFLRTLN   50 (250)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999874


No 283
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=92.49  E-value=0.082  Score=40.90  Aligned_cols=18  Identities=22%  Similarity=0.370  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        41 ~l~G~nGsGKSTLl~~l~   58 (289)
T PRK13645         41 CVIGTTGSGKSTMIQLTN   58 (289)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 284
>PF00025 Arf:  ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins;  InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain.  This entry represents a branch of the small GTPase superfamily that includes the ADP ribosylation factor Arf, Arl (Arf-like), Arp (Arf-related proteins) and the remotely related Sar (Secretion-associated and Ras-related) proteins. Arf proteins are major regulators of vesicle biogenesis in intracellular traffic []. They cycle between inactive GDP-bound and active GTP-bound forms that bind selectively to effectors. The classical structural GDP/GTP switch is characterised by conformational changes at the so-called switch 1 and switch 2 regions, which bind tightly to the gamma-phosphate of GTP but poorly or not at all to the GDP nucleotide. Structural studies of Arf1 and Arf6 have revealed that although these proteins feature the switch 1 and 2 conformational changes, they depart from other small GTP-binding proteins in that they use an additional, unique switch to propagate structural information from one side of the protein to the other.   The GDP/GTP structural cycles of human Arf1 and Arf6 feature a unique conformational change that affects the beta2-beta3 strands connecting switch 1 and switch 2 (interswitch) and also the amphipathic helical N terminus. In GDP-bound Arf1 and Arf6, the interswitch is retracted and forms a pocket to which the N-terminal helix binds, the latter serving as a molecular hasp to maintain the inactive conformation. In the GTP-bound form of these proteins, the interswitch undergoes a two-residue register shift that pulls switch 1 and switch 2 up, restoring an active conformation that can bind GTP. In this conformation, the interswitch projects out of the protein and extrudes the N-terminal hasp by occluding its binding pocket.; GO: 0005525 GTP binding; PDB: 2H57_B 2W83_B 3N5C_B 2J5X_A 3LVR_E 2BAO_A 3LVQ_E 2A5F_A 3PCR_B 1E0S_A ....
Probab=92.49  E-value=0.12  Score=37.02  Aligned_cols=20  Identities=25%  Similarity=0.561  Sum_probs=17.1

Q ss_pred             CcceEecCCCcHHHHHHhhh
Q 046733           85 DTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        85 ~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      ++-|+|+.|.|||||...+.
T Consensus        16 ~ililGl~~sGKTtll~~l~   35 (175)
T PF00025_consen   16 KILILGLDGSGKTTLLNRLK   35 (175)
T ss_dssp             EEEEEESTTSSHHHHHHHHH
T ss_pred             EEEEECCCccchHHHHHHhh
Confidence            34889999999999998764


No 285
>PRK14243 phosphate transporter ATP-binding protein; Provisional
Probab=92.49  E-value=0.083  Score=40.36  Aligned_cols=18  Identities=22%  Similarity=0.457  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        40 ~i~G~nGsGKSTLl~~l~   57 (264)
T PRK14243         40 AFIGPSGCGKSTILRCFN   57 (264)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999999864


No 286
>PRK08451 DNA polymerase III subunits gamma and tau; Validated
Probab=92.46  E-value=0.16  Score=43.83  Aligned_cols=42  Identities=14%  Similarity=0.152  Sum_probs=32.9

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.+..++.|...+...+-... -++|..|.||||+|+.+
T Consensus        14 deiiGqe~v~~~L~~~I~~grl~hayLf~Gp~G~GKTt~Ar~L   56 (535)
T PRK08451         14 DELIGQESVSKTLSLALDNNRLAHAYLFSGLRGSGKTSSARIF   56 (535)
T ss_pred             HHccCcHHHHHHHHHHHHcCCCCeeEEEECCCCCcHHHHHHHH
Confidence            4699999888888888865543333 57899999999999864


No 287
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11. The VirB11 protein is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer. VirB11 is believed to be an ATPase. VirB11 is a homolog of the P-like conjugation system TrbB protein and the Flp pilus sytem protein TadA.
Probab=92.46  E-value=0.17  Score=39.93  Aligned_cols=19  Identities=32%  Similarity=0.447  Sum_probs=16.9

Q ss_pred             cceEecCCCcHHHHHHhhh
Q 046733           86 TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +.|+|..|.|||||++.+.
T Consensus       147 ili~G~tGsGKTTll~al~  165 (308)
T TIGR02788       147 IIISGGTGSGKTTFLKSLV  165 (308)
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            4899999999999999765


No 288
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional
Probab=92.46  E-value=0.083  Score=40.52  Aligned_cols=18  Identities=33%  Similarity=0.737  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        37 ~l~G~nGsGKSTLl~~l~   54 (272)
T PRK15056         37 ALVGVNGSGKSTLFKALM   54 (272)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 289
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional
Probab=92.46  E-value=0.085  Score=39.71  Aligned_cols=18  Identities=22%  Similarity=0.468  Sum_probs=16.4

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+-
T Consensus        34 ~i~G~nGsGKSTLl~~l~   51 (251)
T PRK14270         34 ALIGPSGCGKSTFLRCLN   51 (251)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999999763


No 290
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP.  Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=92.45  E-value=0.086  Score=38.52  Aligned_cols=18  Identities=39%  Similarity=0.466  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        28 ~l~G~nGsGKSTLl~~l~   45 (211)
T cd03298          28 AIVGPSGSGKSTLLNLIA   45 (211)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999764


No 291
>PLN02796 D-glycerate 3-kinase
Probab=92.45  E-value=0.083  Score=43.40  Aligned_cols=18  Identities=22%  Similarity=0.154  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|.|..|.|||||++.+.
T Consensus       104 GI~G~sGSGKSTLa~~L~  121 (347)
T PLN02796        104 GISAPQGCGKTTLVFALV  121 (347)
T ss_pred             EEECCCCCcHHHHHHHHH
Confidence            899999999999999875


No 292
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed
Probab=92.42  E-value=0.15  Score=40.25  Aligned_cols=17  Identities=24%  Similarity=0.567  Sum_probs=15.8

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .++||.|.||||+++.+
T Consensus       137 ~l~G~~GsGKStvg~~L  153 (309)
T PRK08154        137 ALIGLRGAGKSTLGRML  153 (309)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            88899999999999986


No 293
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional
Probab=92.42  E-value=0.09  Score=39.46  Aligned_cols=18  Identities=22%  Similarity=0.490  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        33 ~i~G~nGsGKSTLl~~l~   50 (250)
T PRK14266         33 ALIGPSGCGKSTFIRTLN   50 (250)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            899999999999999874


No 294
>cd04154 Arl2 Arl2 subfamily.  Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity.  Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix.  The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI.  Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different.  In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport.  In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.
Probab=92.41  E-value=0.093  Score=36.75  Aligned_cols=20  Identities=25%  Similarity=0.564  Sum_probs=17.3

Q ss_pred             CcceEecCCCcHHHHHHhhh
Q 046733           85 DTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        85 ~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      ++.|+|.+|+|||||...+.
T Consensus        16 kv~ivG~~~~GKTsL~~~l~   35 (173)
T cd04154          16 RILILGLDNAGKTTILKKLL   35 (173)
T ss_pred             EEEEECCCCCCHHHHHHHHc
Confidence            56899999999999998753


No 295
>PRK00454 engB GTP-binding protein YsxC; Reviewed
Probab=92.39  E-value=0.096  Score=37.05  Aligned_cols=21  Identities=14%  Similarity=0.238  Sum_probs=18.1

Q ss_pred             CcceEecCCCcHHHHHHhhhc
Q 046733           85 DTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        85 ~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      ++.|+|..|.|||||...+..
T Consensus        26 ~v~ivG~~~~GKSsli~~l~~   46 (196)
T PRK00454         26 EIAFAGRSNVGKSSLINALTN   46 (196)
T ss_pred             EEEEEcCCCCCHHHHHHHHhC
Confidence            349999999999999998753


No 296
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit. This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc.
Probab=92.39  E-value=0.085  Score=41.19  Aligned_cols=18  Identities=22%  Similarity=0.337  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        23 ~l~G~NGaGKSTLl~~l~   40 (302)
T TIGR01188        23 GFLGPNGAGKTTTIRMLT   40 (302)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999864


No 297
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit. A number of genomes (actinobacteria, cyanobacteria, betaproteobacteria and pseudomonads) which apparently biosynthesize B12, encode a cobN gene but are demonstrably lacking cobS and cobT. These genomes do, however contain a homolog (modelled here) of the magnesium chelatase subunits BchI/BchD family. Aside from the cyanobacteria (which have a separate magnesium chelatase trimer), these species do not make chlorins, so do not have any use for a magnesium chelatase. Furthermore, in nearly all cases the members of this family are proximal to either CobN itself or other genes involved in cobalt transport or B12 biosynthesis.
Probab=92.38  E-value=0.15  Score=44.29  Aligned_cols=43  Identities=12%  Similarity=0.061  Sum_probs=31.3

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      ..|||.+.-+..+.-.+.......+-|.|..|.||||+|+.+-
T Consensus         4 ~~ivGq~~~~~al~~~av~~~~g~vli~G~~GtgKs~lar~l~   46 (633)
T TIGR02442         4 TAIVGQEDLKLALLLNAVDPRIGGVLIRGEKGTAKSTAARGLA   46 (633)
T ss_pred             chhcChHHHHHHHHHHhhCCCCCeEEEEcCCCCcHHHHHHHHH
Confidence            4689988766666544444433345888999999999999863


No 298
>TIGR03499 FlhF flagellar biosynthetic protein FlhF.
Probab=92.38  E-value=0.085  Score=41.28  Aligned_cols=17  Identities=29%  Similarity=0.575  Sum_probs=15.3

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .++|..|+||||++..+
T Consensus       198 ~~vGptGvGKTTt~~kL  214 (282)
T TIGR03499       198 ALVGPTGVGKTTTLAKL  214 (282)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            88999999999998765


No 299
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional
Probab=92.38  E-value=0.088  Score=39.54  Aligned_cols=18  Identities=22%  Similarity=0.468  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        34 ~i~G~nGsGKSTLl~~l~   51 (251)
T PRK14251         34 ALIGPSGCGKSTFLRCLN   51 (251)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 300
>PLN02318 phosphoribulokinase/uridine kinase
Probab=92.37  E-value=0.14  Score=45.34  Aligned_cols=18  Identities=28%  Similarity=0.446  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|.|..|.||||||+.+.
T Consensus        69 GIaGpSGSGKTTLAk~La   86 (656)
T PLN02318         69 GVAGPSGAGKTVFTEKVL   86 (656)
T ss_pred             EEECCCCCcHHHHHHHHH
Confidence            999999999999999874


No 301
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  Pentoses include xylose, arabinose, and ribose.  Important hexoses include glucose, galactose, and fructose.  In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=92.37  E-value=0.095  Score=37.32  Aligned_cols=18  Identities=28%  Similarity=0.455  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~l~G~nGsGKSTLl~~i~   47 (163)
T cd03216          30 ALLGENGAGKSTLMKILS   47 (163)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999864


No 302
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional
Probab=92.36  E-value=0.092  Score=39.52  Aligned_cols=18  Identities=22%  Similarity=0.401  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        35 ~I~G~nGsGKSTLl~~i~   52 (251)
T PRK14244         35 AFIGPSGCGKSTFLRCFN   52 (251)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            899999999999999864


No 303
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional
Probab=92.35  E-value=0.093  Score=38.74  Aligned_cols=18  Identities=22%  Similarity=0.435  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        41 ~i~G~nGsGKSTLl~~i~   58 (214)
T PRK13543         41 LVQGDNGAGKTTLLRVLA   58 (214)
T ss_pred             EEEcCCCCCHHHHHHHHh
Confidence            899999999999999864


No 304
>PF08298 AAA_PrkA:  PrkA AAA domain;  InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length. PrkA possesses the A-motif of nucleotide-binding proteins and exhibits distant homology to eukaryotic protein kinases []. Note that many of these are hypothetical.
Probab=92.34  E-value=0.12  Score=42.73  Aligned_cols=42  Identities=17%  Similarity=0.268  Sum_probs=34.0

Q ss_pred             CceeecchhHHHHHHHHhcCCC-----CCc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALND-----VDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~-----~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.++..++|++.+.....     .++ -++|.-|.||||||..+
T Consensus        61 ~~~~G~~~~i~~lV~~fk~AA~g~~~~krIl~L~GPvg~GKSsl~~~L  108 (358)
T PF08298_consen   61 DEFYGMEETIERLVNYFKSAAQGLEERKRILLLLGPVGGGKSSLAELL  108 (358)
T ss_pred             ccccCcHHHHHHHHHHHHHHHhccCccceEEEEECCCCCCHHHHHHHH
Confidence            4799999999999998864322     134 77899999999999875


No 305
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional
Probab=92.32  E-value=0.09  Score=39.63  Aligned_cols=18  Identities=22%  Similarity=0.510  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        37 ~i~G~nGsGKSTLl~~l~   54 (254)
T PRK14273         37 ALIGPSGCGKSTFLRTLN   54 (254)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 306
>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton]
Probab=92.32  E-value=0.14  Score=41.36  Aligned_cols=43  Identities=19%  Similarity=0.210  Sum_probs=34.1

Q ss_pred             ceeecchhHHHHHHHHhcCCCC-CcceEecCCCcHHHHHHhhhc
Q 046733           63 FAYGRDGDRNKIINRLSALNDV-DTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        63 ~vvGrd~~~~~lv~~L~~~~~~-~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      ..||+|.-.+.+-..++..... ++-|||-.|+|||||...+|.
T Consensus        25 gyvGidtI~~Qm~~k~mk~GF~FNIMVVgqSglgkstlinTlf~   68 (336)
T KOG1547|consen   25 GYVGIDTIIEQMRKKTMKTGFDFNIMVVGQSGLGKSTLINTLFK   68 (336)
T ss_pred             ccccHHHHHHHHHHHHHhccCceEEEEEecCCCCchhhHHHHHH
Confidence            5789988777777767665544 569999999999999987763


No 307
>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=92.31  E-value=0.092  Score=38.54  Aligned_cols=17  Identities=24%  Similarity=0.317  Sum_probs=15.5

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      -|.|.+|+||||||..+
T Consensus        23 ~i~G~~GsGKT~l~~~~   39 (218)
T cd01394          23 QVYGPPGTGKTNIAIQL   39 (218)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            88999999999999865


No 308
>PRK14235 phosphate transporter ATP-binding protein; Provisional
Probab=92.31  E-value=0.093  Score=40.15  Aligned_cols=18  Identities=22%  Similarity=0.435  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        49 ~i~G~nGsGKSTLl~~l~   66 (267)
T PRK14235         49 AFIGPSGCGKSTFLRCLN   66 (267)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999999874


No 309
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP).  It is responsible for the export the majority of Gram-negative bacterial exoenzymes and toxins. PulE is a cytoplasmic protein of the GSP, which contains an ATP binding site and a tetracysteine motif. This subgroup also includes PillB and HofB.
Probab=92.27  E-value=0.2  Score=39.00  Aligned_cols=39  Identities=18%  Similarity=0.198  Sum_probs=24.0

Q ss_pred             eecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhh
Q 046733           65 YGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        65 vGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~V  103 (106)
                      .|...+....+..+......-+-|.|..|.||||+...+
T Consensus        62 lg~~~~~~~~l~~~~~~~~GlilisG~tGSGKTT~l~al  100 (264)
T cd01129          62 LGLKPENLEIFRKLLEKPHGIILVTGPTGSGKTTTLYSA  100 (264)
T ss_pred             cCCCHHHHHHHHHHHhcCCCEEEEECCCCCcHHHHHHHH
Confidence            455444444444443322222388899999999999865


No 310
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional
Probab=92.24  E-value=0.094  Score=39.34  Aligned_cols=18  Identities=22%  Similarity=0.499  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        33 ~i~G~nGsGKSTLl~~l~   50 (249)
T PRK14253         33 ALIGPSGCGKSTLLRCLN   50 (249)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999999863


No 311
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional
Probab=92.22  E-value=0.094  Score=39.94  Aligned_cols=18  Identities=28%  Similarity=0.521  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        32 ~i~G~nGsGKSTLl~~i~   49 (258)
T PRK13548         32 AILGPNGAGKSTLLRALS   49 (258)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999874


No 312
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK. Members of this family are the PhnK protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated complex. This protein (PhnK) and the adjacent-encoded PhnL resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this complex rather than part of a transporter per se.
Probab=92.20  E-value=0.096  Score=39.38  Aligned_cols=18  Identities=33%  Similarity=0.366  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        33 ~i~G~nGsGKSTLl~~l~   50 (253)
T TIGR02323        33 GIVGESGSGKSTLLGCLA   50 (253)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999764


No 313
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1).  NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters.  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.
Probab=92.20  E-value=0.098  Score=38.19  Aligned_cols=18  Identities=33%  Similarity=0.484  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        38 ~i~G~nGsGKSTLl~~l~   55 (207)
T cd03369          38 GIVGRTGAGKSTLILALF   55 (207)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 314
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]
Probab=92.18  E-value=0.088  Score=45.57  Aligned_cols=17  Identities=29%  Similarity=0.405  Sum_probs=16.2

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .|||-.|.||||||+.+
T Consensus       321 glVGeSGsGKSTlar~i  337 (539)
T COG1123         321 GLVGESGSGKSTLARIL  337 (539)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            99999999999999976


No 315
>TIGR00362 DnaA chromosomal replication initiator protein DnaA. DnaA is involved in DNA biosynthesis; initiation of chromosome replication and can also be transcription regulator. The C-terminal of the family hits the pfam bacterial DnaA (bac_dnaA) domain family. For a review, see Kaguni (2006).
Probab=92.16  E-value=0.091  Score=42.58  Aligned_cols=19  Identities=37%  Similarity=0.307  Sum_probs=17.0

Q ss_pred             ceEecCCCcHHHHHHhhhc
Q 046733           87 VIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy~  105 (106)
                      -|+|..|+|||.|++++++
T Consensus       140 ~l~G~~G~GKThL~~ai~~  158 (405)
T TIGR00362       140 FIYGGVGLGKTHLLHAIGN  158 (405)
T ss_pred             EEECCCCCcHHHHHHHHHH
Confidence            6889999999999998764


No 316
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=92.13  E-value=0.099  Score=40.38  Aligned_cols=18  Identities=33%  Similarity=0.403  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        37 ~i~G~nGsGKSTLl~~l~   54 (279)
T PRK13650         37 SIIGHNGSGKSTTVRLID   54 (279)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999875


No 317
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein.  In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor.  This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export.  The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=92.12  E-value=0.1  Score=38.53  Aligned_cols=17  Identities=35%  Similarity=0.503  Sum_probs=16.0

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .|+|..|.|||||.+.+
T Consensus        33 ~i~G~nGsGKSTLl~~l   49 (229)
T cd03254          33 AIVGPTGAGKTTLINLL   49 (229)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            99999999999999976


No 318
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=92.12  E-value=0.099  Score=40.44  Aligned_cols=18  Identities=33%  Similarity=0.481  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        37 ~I~G~nGaGKSTLl~~l~   54 (282)
T PRK13640         37 ALIGHNGSGKSTISKLIN   54 (282)
T ss_pred             EEECCCCCcHHHHHHHHh
Confidence            999999999999999875


No 319
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional
Probab=92.09  E-value=0.1  Score=39.17  Aligned_cols=18  Identities=28%  Similarity=0.540  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        34 ~i~G~nGsGKSTLl~~i~   51 (252)
T PRK14272         34 ALIGPSGCGKTTFLRAIN   51 (252)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999864


No 320
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=92.08  E-value=0.11  Score=36.32  Aligned_cols=18  Identities=33%  Similarity=0.529  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        29 ~i~G~nGsGKStll~~l~   46 (157)
T cd00267          29 ALVGPNGSGKSTLLRAIA   46 (157)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999874


No 321
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=92.06  E-value=0.1  Score=38.89  Aligned_cols=18  Identities=22%  Similarity=0.547  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        35 ~i~G~nGsGKSTLl~~l~   52 (237)
T PRK11614         35 TLIGANGAGKTTLLGTLC   52 (237)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            899999999999999764


No 322
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit. Model TIGR03731 represents the family of all lantibiotics related to gallidermin, including epidermin, mutatin, and nisin. This protein family describes the ATP-binding subunit of a gallidermin/epidermin class lantibiotic protection transporter. It is largely restricted to gallidermin-family lantibiotic biosynthesis and export cassettes, but also occurs in orphan transporter cassettes in species that lack candidate lantibiotic precursor and synthetase genes.
Probab=92.05  E-value=0.1  Score=38.47  Aligned_cols=18  Identities=33%  Similarity=0.433  Sum_probs=16.4

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~i~G~nGsGKSTLl~~l~   47 (223)
T TIGR03740        30 GLLGPNGAGKSTLLKMIT   47 (223)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999763


No 323
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter.  The CCM family is involved in bacterial cytochrome c biogenesis.  Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH).  CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH.  The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.
Probab=92.05  E-value=0.1  Score=38.09  Aligned_cols=18  Identities=22%  Similarity=0.396  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~i~G~nGsGKSTLl~~l~   47 (201)
T cd03231          30 QVTGPNGSGKTTLLRILA   47 (201)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999764


No 324
>PF13245 AAA_19:  Part of AAA domain
Probab=92.04  E-value=0.12  Score=33.25  Aligned_cols=17  Identities=35%  Similarity=0.472  Sum_probs=13.0

Q ss_pred             ceEecCCCcHH-HHHHhh
Q 046733           87 VIVGIGGLGKI-VVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKT-TLA~~V  103 (106)
                      .|.|..|.||| |++..+
T Consensus        14 vv~g~pGtGKT~~~~~~i   31 (76)
T PF13245_consen   14 VVQGPPGTGKTTTLAARI   31 (76)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            56899999999 555443


No 325
>PF03193 DUF258:  Protein of unknown function, DUF258;  InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis. RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.
Probab=92.04  E-value=0.17  Score=37.28  Aligned_cols=32  Identities=22%  Similarity=0.395  Sum_probs=25.0

Q ss_pred             hhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhhh
Q 046733           69 GDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        69 ~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~Vy  104 (106)
                      +..+.|.++|..    .+ .++|..|+|||||...+.
T Consensus        24 ~g~~~l~~~l~~----k~~vl~G~SGvGKSSLiN~L~   56 (161)
T PF03193_consen   24 EGIEELKELLKG----KTSVLLGQSGVGKSSLINALL   56 (161)
T ss_dssp             TTHHHHHHHHTT----SEEEEECSTTSSHHHHHHHHH
T ss_pred             cCHHHHHHHhcC----CEEEEECCCCCCHHHHHHHHH
Confidence            557778877754    23 788999999999998764


No 326
>PRK05439 pantothenate kinase; Provisional
Probab=92.02  E-value=0.22  Score=40.14  Aligned_cols=17  Identities=24%  Similarity=0.227  Sum_probs=15.6

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .|.|..|+||||||+.+
T Consensus        90 gIaG~~gsGKSTla~~L  106 (311)
T PRK05439         90 GIAGSVAVGKSTTARLL  106 (311)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            88899999999999875


No 327
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=92.02  E-value=0.1  Score=39.95  Aligned_cols=18  Identities=33%  Similarity=0.451  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        39 ~l~G~nGsGKSTLl~~l~   56 (271)
T PRK13632         39 AILGHNGSGKSTISKILT   56 (271)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999764


No 328
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional
Probab=92.00  E-value=0.1  Score=39.96  Aligned_cols=18  Identities=22%  Similarity=0.409  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        42 ~i~G~nGsGKSTLl~~l~   59 (268)
T PRK10419         42 ALLGRSGCGKSTLARLLV   59 (268)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999874


No 329
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=91.96  E-value=0.1  Score=39.84  Aligned_cols=18  Identities=39%  Similarity=0.468  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        39 ~I~G~nGsGKSTLl~~i~   56 (269)
T PRK13648         39 SIVGHNGSGKSTIAKLMI   56 (269)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 330
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional
Probab=91.96  E-value=0.096  Score=41.85  Aligned_cols=18  Identities=33%  Similarity=0.276  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        46 ~ivG~sGsGKSTL~~~l~   63 (330)
T PRK09473         46 GIVGESGSGKSQTAFALM   63 (330)
T ss_pred             EEECCCCchHHHHHHHHH
Confidence            999999999999999874


No 331
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional
Probab=91.95  E-value=0.1  Score=41.79  Aligned_cols=18  Identities=28%  Similarity=0.483  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        35 ~iiG~nGsGKSTLlk~L~   52 (343)
T PRK11153         35 GVIGASGAGKSTLIRCIN   52 (343)
T ss_pred             EEECCCCCcHHHHHHHHh
Confidence            999999999999999864


No 332
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]
Probab=91.95  E-value=0.1  Score=41.19  Aligned_cols=18  Identities=33%  Similarity=0.590  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        34 ~iiGPNGaGKSTLlK~iL   51 (254)
T COG1121          34 ALIGPNGAGKSTLLKAIL   51 (254)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 333
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional
Probab=91.94  E-value=0.1  Score=39.54  Aligned_cols=18  Identities=22%  Similarity=0.510  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        34 ~i~G~nGsGKSTLl~~i~   51 (262)
T PRK09984         34 ALLGPSGSGKSTLLRHLS   51 (262)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 334
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional
Probab=91.94  E-value=0.11  Score=39.06  Aligned_cols=18  Identities=22%  Similarity=0.468  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        32 ~i~G~nGsGKSTLl~~l~   49 (246)
T PRK14269         32 ALIGASGCGKSTFLRCFN   49 (246)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 335
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=91.91  E-value=0.11  Score=40.30  Aligned_cols=18  Identities=44%  Similarity=0.584  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        37 ~i~G~nGsGKSTLl~~L~   54 (286)
T PRK13646         37 AIVGQTGSGKSTLIQNIN   54 (286)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999875


No 336
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional
Probab=91.90  E-value=0.18  Score=44.31  Aligned_cols=42  Identities=12%  Similarity=0.141  Sum_probs=30.8

Q ss_pred             CceeecchhHHHHHHHHhcCCCC-CcceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDV-DTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~-~~~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.+.-+..|.+.+...+.. .+-+.|..|+||||+|+.+
T Consensus        16 ~dIiGQe~v~~~L~~ai~~~ri~ha~Lf~GPpG~GKTtiAril   58 (624)
T PRK14959         16 AEVAGQETVKAILSRAAQENRVAPAYLFSGTRGVGKTTIARIF   58 (624)
T ss_pred             HHhcCCHHHHHHHHHHHHcCCCCceEEEECCCCCCHHHHHHHH
Confidence            46899887777777777554322 2256899999999999864


No 337
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional
Probab=91.89  E-value=0.1  Score=41.60  Aligned_cols=18  Identities=28%  Similarity=0.423  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        45 ~IvG~sGsGKSTLl~~l~   62 (327)
T PRK11308         45 AVVGESGCGKSTLARLLT   62 (327)
T ss_pred             EEECCCCCcHHHHHHHHH
Confidence            999999999999999874


No 338
>PRK14236 phosphate transporter ATP-binding protein; Provisional
Probab=91.89  E-value=0.11  Score=39.91  Aligned_cols=18  Identities=22%  Similarity=0.433  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        55 ~I~G~nGsGKSTLl~~la   72 (272)
T PRK14236         55 AFIGPSGCGKSTLLRCFN   72 (272)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999999863


No 339
>PRK08116 hypothetical protein; Validated
Probab=91.88  E-value=0.1  Score=40.60  Aligned_cols=20  Identities=25%  Similarity=0.165  Sum_probs=17.6

Q ss_pred             cceEecCCCcHHHHHHhhhc
Q 046733           86 TVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      +-++|..|+|||.||.+|++
T Consensus       117 l~l~G~~GtGKThLa~aia~  136 (268)
T PRK08116        117 LLLWGSVGTGKTYLAACIAN  136 (268)
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            37889999999999998864


No 340
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional
Probab=91.87  E-value=0.11  Score=40.21  Aligned_cols=18  Identities=39%  Similarity=0.425  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        54 ~liG~NGsGKSTLlk~L~   71 (264)
T PRK13546         54 GLVGINGSGKSTLSNIIG   71 (264)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999864


No 341
>PF00308 Bac_DnaA:  Bacterial dnaA  protein;  InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication. DnaA is an ATP- and DNA-binding protein. It binds specifically to 9 bp nucleotide repeats known as dnaA boxes which are found in the chromosome origin of replication (oriC). DnaA is a protein of about 50 kDa that contains two conserved regions: the first is located in the N-terminal half and corresponds to the ATP-binding domain, the second is located in the C-terminal half and could be involved in DNA-binding. The protein may also bind the RNA polymerase beta subunit, the dnaB and dnaZ proteins, and the groE gene products (chaperonins) [].; PDB: 2KJQ_A 2Z4S_A 2Z4R_C 2HCB_B 3R8F_C 1L8Q_A 3SC3_B 3BOS_A.
Probab=91.85  E-value=0.33  Score=36.57  Aligned_cols=44  Identities=18%  Similarity=0.224  Sum_probs=26.3

Q ss_pred             Cceeecc-hhHHHHHHHHhcCCCC--C-cceEecCCCcHHHHHHhhhc
Q 046733           62 KFAYGRD-GDRNKIINRLSALNDV--D-TVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        62 ~~vvGrd-~~~~~lv~~L~~~~~~--~-~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      .-++|.. +..-..+..+......  + +-|+|..|+|||.|.+++++
T Consensus         9 nfv~g~~N~~a~~~~~~ia~~~~~~~~~l~l~G~~G~GKTHLL~Ai~~   56 (219)
T PF00308_consen    9 NFVVGESNELAYAAAKAIAENPGERYNPLFLYGPSGLGKTHLLQAIAN   56 (219)
T ss_dssp             CS--TTTTHHHHHHHHHHHHSTTTSSSEEEEEESTTSSHHHHHHHHHH
T ss_pred             cCCcCCcHHHHHHHHHHHHhcCCCCCCceEEECCCCCCHHHHHHHHHH
Confidence            3566653 2233344444443332  2 28889999999999999864


No 342
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional
Probab=91.84  E-value=0.11  Score=39.40  Aligned_cols=18  Identities=22%  Similarity=0.447  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        42 ~i~G~nGsGKSTLl~~i~   59 (258)
T PRK14268         42 ALIGPSGCGKSTFIRCLN   59 (258)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999864


No 343
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated
Probab=91.83  E-value=0.21  Score=43.18  Aligned_cols=18  Identities=28%  Similarity=0.543  Sum_probs=16.2

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      -|+|+.|.||||+|+.+.
T Consensus       396 vl~Gl~GSGKSTia~~La  413 (568)
T PRK05537        396 FFTGLSGAGKSTIAKALM  413 (568)
T ss_pred             EEECCCCChHHHHHHHHH
Confidence            777999999999999874


No 344
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=91.81  E-value=0.11  Score=40.04  Aligned_cols=18  Identities=22%  Similarity=0.447  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        35 ~i~G~nGsGKSTLl~~l~   52 (274)
T PRK13647         35 ALLGPNGAGKSTLLLHLN   52 (274)
T ss_pred             EEECCCCCcHHHHHHHHh
Confidence            999999999999999864


No 345
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional
Probab=91.81  E-value=0.11  Score=39.65  Aligned_cols=18  Identities=28%  Similarity=0.554  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        37 ~i~G~nGsGKSTLl~~i~   54 (265)
T PRK10253         37 AIIGPNGCGKSTLLRTLS   54 (265)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            999999999999999864


No 346
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE. This family represents the NikE subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase.
Probab=91.80  E-value=0.11  Score=39.59  Aligned_cols=18  Identities=22%  Similarity=0.366  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        41 ~i~G~nGsGKSTLl~~l~   58 (265)
T TIGR02769        41 GLLGRSGCGKSTLARLLL   58 (265)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999764


No 347
>cd01878 HflX HflX subfamily.  A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily.  The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear.  HflX is widespread, but not universally represented in all three superkingdoms.
Probab=91.79  E-value=0.12  Score=37.15  Aligned_cols=19  Identities=21%  Similarity=0.441  Sum_probs=16.7

Q ss_pred             cceEecCCCcHHHHHHhhh
Q 046733           86 TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +.|+|.+|+|||||.+.+.
T Consensus        44 I~iiG~~g~GKStLl~~l~   62 (204)
T cd01878          44 VALVGYTNAGKSTLFNALT   62 (204)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            4999999999999998764


No 348
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional
Probab=91.75  E-value=0.19  Score=43.76  Aligned_cols=42  Identities=14%  Similarity=0.213  Sum_probs=33.3

Q ss_pred             CceeecchhHHHHHHHHhcCCCCC-cceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVD-TVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~-~~IvGmGGiGKTTLA~~V  103 (106)
                      .+++|.+..++.|...+....-.. +=+.|.-|+||||+|+.+
T Consensus        17 ~~viGq~~~~~~L~~~i~~~~l~hayLf~Gp~G~GKtt~A~~l   59 (614)
T PRK14971         17 ESVVGQEALTTTLKNAIATNKLAHAYLFCGPRGVGKTTCARIF   59 (614)
T ss_pred             HHhcCcHHHHHHHHHHHHcCCCCeeEEEECCCCCCHHHHHHHH
Confidence            469999999999998886654433 267899999999999763


No 349
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=91.71  E-value=0.12  Score=38.52  Aligned_cols=18  Identities=39%  Similarity=0.566  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        32 ~l~G~nGsGKSTLl~~l~   49 (242)
T TIGR03411        32 VIIGPNGAGKTTMMDVIT   49 (242)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999764


No 350
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]
Probab=91.70  E-value=0.11  Score=46.19  Aligned_cols=18  Identities=39%  Similarity=0.532  Sum_probs=16.8

Q ss_pred             cceEecCCCcHHHHHHhh
Q 046733           86 TVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~V  103 (106)
                      +.|||-.|.|||||+|.+
T Consensus       502 vaIvG~SGsGKSTL~KLL  519 (709)
T COG2274         502 VAIVGRSGSGKSTLLKLL  519 (709)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            499999999999999986


No 351
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=91.70  E-value=0.12  Score=39.83  Aligned_cols=18  Identities=33%  Similarity=0.466  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~IvG~nGsGKSTLlk~l~   47 (255)
T cd03236          30 GLVGPNGIGKSTALKILA   47 (255)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 352
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional
Probab=91.69  E-value=0.12  Score=39.91  Aligned_cols=18  Identities=22%  Similarity=0.446  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        51 ~I~G~nGsGKSTLl~~l~   68 (276)
T PRK14271         51 SLMGPTGSGKTTFLRTLN   68 (276)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 353
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional
Probab=91.68  E-value=0.12  Score=39.39  Aligned_cols=18  Identities=22%  Similarity=0.435  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        46 ~i~G~nGsGKSTLl~~l~   63 (265)
T PRK14252         46 ALIGPSGCGKSTFLRCFN   63 (265)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 354
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional
Probab=91.66  E-value=0.12  Score=38.87  Aligned_cols=17  Identities=29%  Similarity=0.608  Sum_probs=16.1

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .|+|..|.|||||.+.+
T Consensus        34 ~i~G~nGsGKSTLl~~l   50 (251)
T PRK14249         34 AIIGPSGCGKSTLLRAL   50 (251)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            99999999999999976


No 355
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]
Probab=91.65  E-value=0.18  Score=45.40  Aligned_cols=42  Identities=19%  Similarity=0.312  Sum_probs=32.2

Q ss_pred             CceeecchhHHHHHHHHhcCCCC----Cc-----ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDV----DT-----VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~----~~-----~IvGmGGiGKTTLA~~V  103 (106)
                      ..|+|.++.++.+.+-+...+..    +-     --+|+.|+|||-||+.+
T Consensus       491 ~rViGQd~AV~avs~aIrraRaGL~dp~rPigsFlF~GPTGVGKTELAkaL  541 (786)
T COG0542         491 KRVIGQDEAVEAVSDAIRRARAGLGDPNRPIGSFLFLGPTGVGKTELAKAL  541 (786)
T ss_pred             cceeChHHHHHHHHHHHHHHhcCCCCCCCCceEEEeeCCCcccHHHHHHHH
Confidence            57999999999998887654321    11     33799999999999874


No 356
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=91.63  E-value=0.12  Score=37.55  Aligned_cols=18  Identities=33%  Similarity=0.435  Sum_probs=16.4

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        35 ~i~G~nG~GKSTLl~~i~   52 (204)
T cd03250          35 AIVGPVGSGKSSLLSALL   52 (204)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999764


No 357
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional
Probab=91.63  E-value=0.12  Score=39.52  Aligned_cols=18  Identities=33%  Similarity=0.442  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        43 ~i~G~NGsGKSTLl~~l~   60 (267)
T PRK15112         43 AIIGENGSGKSTLAKMLA   60 (267)
T ss_pred             EEEcCCCCCHHHHHHHHh
Confidence            999999999999999864


No 358
>smart00350 MCM minichromosome  maintenance proteins.
Probab=91.63  E-value=0.21  Score=42.22  Aligned_cols=44  Identities=18%  Similarity=0.201  Sum_probs=31.8

Q ss_pred             CceeecchhHHHHHHHHhcCCC------C------CcceEecCCCcHHHHHHhhhc
Q 046733           62 KFAYGRDGDRNKIINRLSALND------V------DTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~------~------~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      +.++|.+..+..|+-.|.....      .      ++-|+|-.|.|||+||+.+..
T Consensus       203 p~i~G~~~~k~~l~l~l~gg~~~~~~~~~~~r~~~~vLL~G~pGtGKs~lar~l~~  258 (509)
T smart00350      203 PSIYGHEDIKKAILLLLFGGVHKNLPDGMKIRGDINILLLGDPGTAKSQLLKYVEK  258 (509)
T ss_pred             ccccCcHHHHHHHHHHHhCCCccccCCCccccccceEEEeCCCChhHHHHHHHHHH
Confidence            5788988776666666654321      0      237889999999999998754


No 359
>PRK03695 vitamin B12-transporter ATPase; Provisional
Probab=91.61  E-value=0.12  Score=39.12  Aligned_cols=18  Identities=28%  Similarity=0.433  Sum_probs=16.4

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        26 ~l~G~nGsGKSTLl~~l~   43 (248)
T PRK03695         26 HLVGPNGAGKSTLLARMA   43 (248)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            999999999999999763


No 360
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional
Probab=91.61  E-value=0.12  Score=40.05  Aligned_cols=18  Identities=28%  Similarity=0.506  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        31 ~l~G~nGsGKSTLl~~la   48 (272)
T PRK13547         31 ALLGRNGAGKSTLLKALA   48 (272)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 361
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=91.58  E-value=0.19  Score=42.77  Aligned_cols=44  Identities=16%  Similarity=0.091  Sum_probs=28.9

Q ss_pred             CceeecchhHHHHHHHHhcCC------------CCCcceEecCCCcHHHHHHhhhc
Q 046733           62 KFAYGRDGDRNKIINRLSALN------------DVDTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~------------~~~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      .+|.|..+.++-|.+-+.-+-            +..+-.+|..|.|||-||++|+.
T Consensus       212 ~DIagl~~AK~lL~EAVvlPi~mPe~F~GirrPWkgvLm~GPPGTGKTlLAKAvAT  267 (491)
T KOG0738|consen  212 DDIAGLHEAKKLLKEAVVLPIWMPEFFKGIRRPWKGVLMVGPPGTGKTLLAKAVAT  267 (491)
T ss_pred             HhhcchHHHHHHHHHHHhhhhhhHHHHhhcccccceeeeeCCCCCcHHHHHHHHHH
Confidence            356677666665554432211            11236779999999999999975


No 362
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family. Members of this protein family are found mostly in the Cyanobacteria, but also in the Planctomycetes. Cyanobacterial examples are involved in heterocyst formation, by which some fraction of members of the colony undergo a developmental change and become capable of nitrogen fixation. The DevBCA proteins are thought export of either heterocyst-specific glycolipids or an enzyme essential for formation of the laminated layer found in heterocysts.
Probab=91.57  E-value=0.13  Score=38.03  Aligned_cols=18  Identities=28%  Similarity=0.412  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        35 ~I~G~nGsGKStLl~~l~   52 (220)
T TIGR02982        35 ILTGPSGSGKTTLLTLIG   52 (220)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 363
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=91.57  E-value=0.12  Score=39.69  Aligned_cols=18  Identities=22%  Similarity=0.494  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        32 ~l~G~nGsGKSTLl~~i~   49 (275)
T PRK13639         32 ALLGPNGAGKSTLFLHFN   49 (275)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999874


No 364
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional
Probab=91.56  E-value=0.25  Score=40.31  Aligned_cols=44  Identities=18%  Similarity=0.216  Sum_probs=32.7

Q ss_pred             CceeecchhHHHHHHHHhcCCCC--CcceEecCCCcHHHHHHhhhc
Q 046733           62 KFAYGRDGDRNKIINRLSALNDV--DTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~--~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      ..++|.......+...+......  .+-|.|-.|.||+++|+.++.
T Consensus       138 ~~lig~s~~~~~l~~~~~~~~~~~~~vli~Ge~GtGK~~lA~~ih~  183 (469)
T PRK10923        138 TDIIGEAPAMQDVFRIIGRLSRSSISVLINGESGTGKELVAHALHR  183 (469)
T ss_pred             ccceecCHHHHHHHHHHHHHhccCCeEEEEeCCCCcHHHHHHHHHh
Confidence            35888887777777666432222  348889999999999999875


No 365
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit. This model describes the aerobic cobalamin pathway Pseudomonas denitrificans CobS gene product, which is a cobalt chelatase subunit, with a MW ~37 kDa. The aerobic pathway cobalt chelatase is a heterotrimeric, ATP-dependent enzyme that catalyzes cobalt insertion during cobalamin biosynthesis. The other two subunits are the P. denitrificans CobT (TIGR01651) and CobN (pfam02514 CobN/Magnesium Chelatase) proteins. To avoid potential confusion with the nonhomologous Salmonella typhimurium/E.coli cobS gene product, the P. denitrificans gene symbol is not used in the name of this model.
Probab=91.56  E-value=0.36  Score=39.35  Aligned_cols=32  Identities=19%  Similarity=0.205  Sum_probs=22.8

Q ss_pred             hHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhh
Q 046733           70 DRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        70 ~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~V  103 (106)
                      ....++..|...  ..+-|.|..|+||||||+.+
T Consensus        53 ~~~~vl~~l~~~--~~ilL~G~pGtGKTtla~~l   84 (327)
T TIGR01650        53 TTKAICAGFAYD--RRVMVQGYHGTGKSTHIEQI   84 (327)
T ss_pred             HHHHHHHHHhcC--CcEEEEeCCCChHHHHHHHH
Confidence            344566655432  23588999999999999976


No 366
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional
Probab=91.56  E-value=0.12  Score=43.47  Aligned_cols=19  Identities=26%  Similarity=0.380  Sum_probs=17.1

Q ss_pred             cceEecCCCcHHHHHHhhh
Q 046733           86 TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +.|+|..|.|||||++.+.
T Consensus       372 ~aIvG~sGsGKSTLl~ll~  390 (582)
T PRK11176        372 VALVGRSGSGKSTIANLLT  390 (582)
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            3999999999999999864


No 367
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .
Probab=91.55  E-value=0.13  Score=37.98  Aligned_cols=18  Identities=28%  Similarity=0.294  Sum_probs=16.3

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||+||..+.
T Consensus        23 ~i~G~~GsGKT~l~~~l~   40 (235)
T cd01123          23 EIFGEFGSGKTQLCHQLA   40 (235)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999998763


No 368
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]
Probab=91.54  E-value=0.12  Score=43.39  Aligned_cols=20  Identities=35%  Similarity=0.431  Sum_probs=17.6

Q ss_pred             cceEecCCCcHHHHHHhhhc
Q 046733           86 TVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      +.|||..|.|||||++.+.-
T Consensus       358 vaiVG~sGsGKSTl~~LL~r  377 (567)
T COG1132         358 VAIVGPSGSGKSTLIKLLLR  377 (567)
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            49999999999999998753


No 369
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional
Probab=91.51  E-value=0.12  Score=40.05  Aligned_cols=18  Identities=33%  Similarity=0.540  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        69 ~l~G~nGsGKSTLl~~L~   86 (286)
T PRK14275         69 AIIGPSGCGKSTFLRAIN   86 (286)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999874


No 370
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins.
Probab=91.50  E-value=0.17  Score=45.41  Aligned_cols=43  Identities=16%  Similarity=0.239  Sum_probs=33.1

Q ss_pred             CceeecchhHHHHHHHHhcCCC-----C---C-cceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALND-----V---D-TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~-----~---~-~~IvGmGGiGKTTLA~~Vy  104 (106)
                      ..++|.+..++.|...+.....     .   . +-++|..|+|||+||+.+-
T Consensus       565 ~~v~GQ~~av~~v~~~i~~~~~gl~~~~~p~~~~Lf~Gp~GvGKt~lA~~La  616 (852)
T TIGR03346       565 ERVVGQDEAVEAVSDAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELAKALA  616 (852)
T ss_pred             cccCCChHHHHHHHHHHHHHhccCCCCCCCCeEEEEEcCCCCCHHHHHHHHH
Confidence            4699999999999888864321     1   1 2678999999999999763


No 371
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI. This model does not recognize the highly divergent NodI from Azorhizobium caulinodans.
Probab=91.50  E-value=0.12  Score=40.29  Aligned_cols=18  Identities=22%  Similarity=0.407  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        34 ~l~G~NGaGKSTLl~~l~   51 (303)
T TIGR01288        34 GLLGPNGAGKSTIARMLL   51 (303)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 372
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]
Probab=91.48  E-value=0.11  Score=46.64  Aligned_cols=42  Identities=26%  Similarity=0.395  Sum_probs=29.9

Q ss_pred             CceeecchhHHHHHHH---HhcCCC---C------CcceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINR---LSALND---V------DTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~---L~~~~~---~------~~~IvGmGGiGKTTLA~~V  103 (106)
                      .+|-|.|+.+++|++.   |.++..   .      .+-++|..|.|||-||+++
T Consensus       311 kDVAG~deAK~El~E~V~fLKNP~~Y~~lGAKiPkGvLL~GPPGTGKTLLAKAi  364 (774)
T KOG0731|consen  311 KDVAGVDEAKEELMEFVKFLKNPEQYQELGAKIPKGVLLVGPPGTGKTLLAKAI  364 (774)
T ss_pred             ccccCcHHHHHHHHHHHHHhcCHHHHHHcCCcCcCceEEECCCCCcHHHHHHHH
Confidence            3688998777766554   444321   1      1278899999999999987


No 373
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=91.47  E-value=0.13  Score=39.68  Aligned_cols=18  Identities=22%  Similarity=0.612  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        34 ~i~G~NGsGKSTLl~~l~   51 (277)
T PRK13652         34 AVIGPNGAGKSTLFRHFN   51 (277)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 374
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional
Probab=91.46  E-value=0.13  Score=39.11  Aligned_cols=18  Identities=33%  Similarity=0.499  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        37 ~I~G~nGsGKSTLl~~l~   54 (261)
T PRK14258         37 AIIGPSGCGKSTFLKCLN   54 (261)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 375
>PRK10865 protein disaggregation chaperone; Provisional
Probab=91.45  E-value=0.24  Score=44.57  Aligned_cols=43  Identities=16%  Similarity=0.271  Sum_probs=32.5

Q ss_pred             CceeecchhHHHHHHHHhcCC------CC--C-cceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALN------DV--D-TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~------~~--~-~~IvGmGGiGKTTLA~~Vy  104 (106)
                      ..++|.+..++.|...+....      ..  . +-++|..|+|||+||+.+.
T Consensus       568 ~~viGQ~~ai~~l~~~i~~~~~gl~~~~~p~~~~Lf~Gp~G~GKT~lA~aLa  619 (857)
T PRK10865        568 HRVIGQNEAVEAVSNAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKALA  619 (857)
T ss_pred             CeEeCCHHHHHHHHHHHHHHHhcccCCCCCCceEEEECCCCCCHHHHHHHHH
Confidence            469999999888888775321      11  1 2678999999999999875


No 376
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of the D-methionine ABC transporter complex. Known members belong to the Proteobacteria.
Probab=91.44  E-value=0.12  Score=41.69  Aligned_cols=18  Identities=22%  Similarity=0.466  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        35 gIiG~sGaGKSTLlr~I~   52 (343)
T TIGR02314        35 GVIGASGAGKSTLIRCVN   52 (343)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 377
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1.  The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia.  Use of the term assembly of a functional ion channel implies the coming together of subunits, or at least smaller not-yet functional components of the active whole.  In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells.  CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=91.43  E-value=0.13  Score=40.29  Aligned_cols=18  Identities=33%  Similarity=0.394  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        67 ~liG~NGsGKSTLl~~I~   84 (282)
T cd03291          67 AITGSTGSGKTSLLMLIL   84 (282)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999875


No 378
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=91.38  E-value=0.13  Score=39.81  Aligned_cols=18  Identities=28%  Similarity=0.468  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        37 ~iiG~NGaGKSTLl~~l~   54 (287)
T PRK13641         37 ALVGHTGSGKSTLMQHFN   54 (287)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999875


No 379
>PRK12422 chromosomal replication initiation protein; Provisional
Probab=91.38  E-value=0.12  Score=43.17  Aligned_cols=19  Identities=21%  Similarity=0.282  Sum_probs=17.0

Q ss_pred             ceEecCCCcHHHHHHhhhc
Q 046733           87 VIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy~  105 (106)
                      -|+|..|+|||+|++++.+
T Consensus       145 ~L~G~~G~GKTHLl~Ai~~  163 (445)
T PRK12422        145 YLFGPEGSGKTHLMQAAVH  163 (445)
T ss_pred             EEEcCCCCCHHHHHHHHHH
Confidence            7899999999999998754


No 380
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional
Probab=91.35  E-value=0.13  Score=41.17  Aligned_cols=18  Identities=33%  Similarity=0.423  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        51 ~lvG~sGsGKSTLlk~i~   68 (331)
T PRK15079         51 GVVGESGCGKSTFARAII   68 (331)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999999874


No 381
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional
Probab=91.34  E-value=0.26  Score=42.31  Aligned_cols=44  Identities=14%  Similarity=0.140  Sum_probs=34.3

Q ss_pred             CceeecchhHHHHHHHHhcCCCC--CcceEecCCCcHHHHHHhhhc
Q 046733           62 KFAYGRDGDRNKIINRLSALNDV--DTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~--~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      +.++|......++++.+..-...  .+-|.|-.|.||+++|+.++.
T Consensus       325 ~~l~g~s~~~~~~~~~~~~~a~~~~pvli~Ge~GtGK~~~A~~ih~  370 (638)
T PRK11388        325 DHMPQDSPQMRRLIHFGRQAAKSSFPVLLCGEEGVGKALLAQAIHN  370 (638)
T ss_pred             cceEECCHHHHHHHHHHHHHhCcCCCEEEECCCCcCHHHHHHHHHH
Confidence            46889988888888877543322  347889999999999999874


No 382
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein. This model represents the ATP-binding cassette (ABC) protein of the three subunit molybdate ABC transporter. The three proteins of this complex are homologous to proteins of the sulfate ABC transporter. Molybdenum may be used in nitrogenases of nitrogen-fixing bacteria and in molybdopterin cofactors. In some cases, molybdate may be transported by a sulfate transporter rather than by a specific molybdate transporter.
Probab=91.34  E-value=0.13  Score=41.23  Aligned_cols=18  Identities=33%  Similarity=0.446  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        27 ~l~G~nGsGKSTLl~~ia   44 (354)
T TIGR02142        27 AIFGRSGSGKTTLIRLIA   44 (354)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 383
>PRK14088 dnaA chromosomal replication initiation protein; Provisional
Probab=91.30  E-value=0.13  Score=42.84  Aligned_cols=20  Identities=35%  Similarity=0.305  Sum_probs=17.5

Q ss_pred             cceEecCCCcHHHHHHhhhc
Q 046733           86 TVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      +-|+|..|+|||.|++++.+
T Consensus       133 l~lyG~~G~GKTHLl~ai~~  152 (440)
T PRK14088        133 LFIYGGVGLGKTHLLQSIGN  152 (440)
T ss_pred             EEEEcCCCCcHHHHHHHHHH
Confidence            37889999999999998764


No 384
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]
Probab=91.29  E-value=0.14  Score=39.81  Aligned_cols=18  Identities=33%  Similarity=0.411  Sum_probs=16.2

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|+|||||-..+.
T Consensus        35 aI~GpSGSGKSTLLniig   52 (226)
T COG1136          35 AIVGPSGSGKSTLLNLLG   52 (226)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999987654


No 385
>PRK13651 cobalt transporter ATP-binding subunit; Provisional
Probab=91.27  E-value=0.14  Score=40.47  Aligned_cols=18  Identities=28%  Similarity=0.494  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        37 ~iiG~nGsGKSTLl~~L~   54 (305)
T PRK13651         37 AIIGQTGSGKTTFIEHLN   54 (305)
T ss_pred             EEECCCCCcHHHHHHHHh
Confidence            999999999999999864


No 386
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional
Probab=91.27  E-value=0.13  Score=41.28  Aligned_cols=18  Identities=33%  Similarity=0.464  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        28 ~l~G~nGsGKSTLl~~ia   45 (352)
T PRK11144         28 AIFGRSGAGKTSLINAIS   45 (352)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 387
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional
Probab=91.25  E-value=0.13  Score=43.07  Aligned_cols=18  Identities=39%  Similarity=0.477  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        39 ~iiG~nGsGKSTLl~~i~   56 (529)
T PRK15134         39 ALVGESGSGKSVTALSIL   56 (529)
T ss_pred             EEECCCCCcHHHHHHHHh
Confidence            999999999999998763


No 388
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=91.24  E-value=0.14  Score=39.61  Aligned_cols=18  Identities=33%  Similarity=0.628  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        36 ~i~G~nGaGKSTLl~~i~   53 (283)
T PRK13636         36 AILGGNGAGKSTLFQNLN   53 (283)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999875


No 389
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=91.18  E-value=0.14  Score=39.77  Aligned_cols=18  Identities=22%  Similarity=0.501  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        36 ~i~G~nGsGKSTLl~~l~   53 (288)
T PRK13643         36 ALIGHTGSGKSTLLQHLN   53 (288)
T ss_pred             EEECCCCChHHHHHHHHh
Confidence            999999999999999864


No 390
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for
Probab=91.17  E-value=0.14  Score=38.81  Aligned_cols=19  Identities=32%  Similarity=0.501  Sum_probs=17.3

Q ss_pred             ceEecCCCcHHHHHHhhhc
Q 046733           87 VIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy~  105 (106)
                      .|+|..|.|||||..+|+.
T Consensus        26 ~i~G~NGsGKStll~ai~~   44 (247)
T cd03275          26 CIIGPNGSGKSNLMDAISF   44 (247)
T ss_pred             EEECCCCCCHHHHHHHHHH
Confidence            8999999999999998763


No 391
>PF13481 AAA_25:  AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.
Probab=91.13  E-value=0.18  Score=35.92  Aligned_cols=17  Identities=29%  Similarity=0.425  Sum_probs=15.2

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      -|.|.+|+||||++..+
T Consensus        36 ~i~g~~g~GKT~~~~~l   52 (193)
T PF13481_consen   36 LIAGPPGSGKTTLALQL   52 (193)
T ss_dssp             EEEECSTSSHHHHHHHH
T ss_pred             EEEeCCCCCHHHHHHHH
Confidence            88899999999998764


No 392
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type. E. coli NadR has also been found to regulate the import of its substrate, nicotinamide ribonucleotide, but it is not known if the other members of this model share that activity.
Probab=91.12  E-value=0.14  Score=40.96  Aligned_cols=18  Identities=22%  Similarity=0.333  Sum_probs=16.1

Q ss_pred             cceEecCCCcHHHHHHhh
Q 046733           86 TVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~V  103 (106)
                      +.|+|..|.|||||++.+
T Consensus       165 ~~~~G~~~~gkstl~~~l  182 (325)
T TIGR01526       165 VAILGGESTGKSTLVNKL  182 (325)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            388999999999999975


No 393
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=91.10  E-value=0.15  Score=39.65  Aligned_cols=18  Identities=22%  Similarity=0.418  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        37 ~i~G~nGaGKSTLl~~l~   54 (287)
T PRK13637         37 GLIGHTGSGKSTLIQHLN   54 (287)
T ss_pred             EEECCCCCcHHHHHHHHh
Confidence            999999999999999864


No 394
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=91.09  E-value=0.15  Score=39.29  Aligned_cols=18  Identities=28%  Similarity=0.370  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        32 ~i~G~nGsGKSTLl~~l~   49 (274)
T PRK13644         32 GIIGKNGSGKSTLALHLN   49 (274)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999875


No 395
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional
Probab=91.05  E-value=0.15  Score=39.99  Aligned_cols=18  Identities=22%  Similarity=0.468  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        75 ~IvG~nGsGKSTLl~~L~   92 (305)
T PRK14264         75 ALIGPSGCGKSTFLRCLN   92 (305)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999874


No 396
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR).  DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.
Probab=91.02  E-value=0.15  Score=37.14  Aligned_cols=18  Identities=28%  Similarity=0.477  Sum_probs=16.4

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        39 ~l~G~nGsGKStLl~~i~   56 (194)
T cd03213          39 AIMGPSGAGKSTLLNALA   56 (194)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999763


No 397
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=91.00  E-value=0.15  Score=40.54  Aligned_cols=18  Identities=28%  Similarity=0.446  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        56 ~I~G~nGsGKSTLl~~L~   73 (320)
T PRK13631         56 FIIGNSGSGKSTLVTHFN   73 (320)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999875


No 398
>PLN02348 phosphoribulokinase
Probab=90.99  E-value=0.24  Score=41.44  Aligned_cols=18  Identities=17%  Similarity=0.239  Sum_probs=16.4

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|.|..|.||||||+.+.
T Consensus        53 GIaG~SGSGKSTfA~~L~   70 (395)
T PLN02348         53 GLAADSGCGKSTFMRRLT   70 (395)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            899999999999999764


No 399
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional
Probab=90.98  E-value=0.19  Score=40.34  Aligned_cols=17  Identities=24%  Similarity=0.319  Sum_probs=15.4

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .|+|..|.|||||...+
T Consensus       108 ~l~G~pGsGKTTLl~~l  124 (290)
T PRK10463        108 NLVSSPGSGKTTLLTET  124 (290)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            89999999999999754


No 400
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional
Probab=90.98  E-value=0.15  Score=42.20  Aligned_cols=18  Identities=28%  Similarity=0.455  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        33 ~liG~nGsGKSTLl~~l~   50 (490)
T PRK10938         33 AFVGANGSGKSALARALA   50 (490)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 401
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component.  Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems.  The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions.  The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.
Probab=90.97  E-value=0.16  Score=37.20  Aligned_cols=18  Identities=33%  Similarity=0.503  Sum_probs=16.3

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~i~G~nGsGKStLl~~l~   47 (200)
T cd03217          30 ALMGPNGSGKSTLAKTIM   47 (200)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999753


No 402
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.
Probab=90.95  E-value=0.15  Score=42.59  Aligned_cols=18  Identities=33%  Similarity=0.447  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~iiG~nGsGKSTLl~~l~   47 (520)
T TIGR03269        30 GILGRSGAGKSVLMHVLR   47 (520)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 403
>PRK13765 ATP-dependent protease Lon; Provisional
Probab=90.93  E-value=0.21  Score=43.87  Aligned_cols=41  Identities=17%  Similarity=0.242  Sum_probs=31.3

Q ss_pred             CceeecchhHHHHHHHHhcCCCCCcceEecCCCcHHHHHHhhh
Q 046733           62 KFAYGRDGDRNKIINRLSALNDVDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+++|.++.++.|...+....  .+-++|..|.||||||+.+.
T Consensus        31 ~~vigq~~a~~~L~~~~~~~~--~~l~~G~~G~GKttla~~l~   71 (637)
T PRK13765         31 DQVIGQEHAVEVIKKAAKQRR--HVMMIGSPGTGKSMLAKAMA   71 (637)
T ss_pred             HHcCChHHHHHHHHHHHHhCC--eEEEECCCCCcHHHHHHHHH
Confidence            468898888887776555432  34888999999999998753


No 404
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor. Ras homologues involved in vesicular transport. Activator of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. ARFs are N-terminally myristoylated. Contains ATP/GTP-binding motif (P-loop).
Probab=90.93  E-value=0.24  Score=35.09  Aligned_cols=19  Identities=21%  Similarity=0.504  Sum_probs=16.5

Q ss_pred             CcceEecCCCcHHHHHHhh
Q 046733           85 DTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        85 ~~~IvGmGGiGKTTLA~~V  103 (106)
                      ++.++|.+|+|||+|...+
T Consensus        15 ki~l~G~~~~GKTsL~~~~   33 (175)
T smart00177       15 RILMVGLDAAGKTTILYKL   33 (175)
T ss_pred             EEEEEcCCCCCHHHHHHHH
Confidence            3489999999999998765


No 405
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form slid
Probab=90.92  E-value=0.16  Score=37.78  Aligned_cols=17  Identities=29%  Similarity=0.393  Sum_probs=15.8

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .|+|..|.|||||.+.+
T Consensus        29 ~ltGpNg~GKSTllr~i   45 (199)
T cd03283          29 LITGSNMSGKSTFLRTI   45 (199)
T ss_pred             EEECCCCCChHHHHHHH
Confidence            89999999999999875


No 406
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein. Several bacterial species have enzymes xylose isomerase and xylulokinase enzymes for xylose utilization. Members of this protein family are the ATP-binding cassette (ABC) subunit of the known or predicted high-affinity xylose ABC transporter for xylose import. These genes, which closely resemble other sugar transport ABC transporter genes, typically are encoded near xylose utilization enzymes and regulatory proteins. Note that this form of the transporter contains two copies of the ABC transporter domain (pfam00005).
Probab=90.92  E-value=0.15  Score=42.26  Aligned_cols=18  Identities=28%  Similarity=0.359  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        31 ~liG~nGsGKSTLl~~i~   48 (500)
T TIGR02633        31 GLCGENGAGKSTLMKILS   48 (500)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999874


No 407
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional
Probab=90.91  E-value=0.15  Score=41.35  Aligned_cols=18  Identities=39%  Similarity=0.532  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        33 ~l~G~nGsGKSTLL~~ia   50 (369)
T PRK11000         33 VFVGPSGCGKSTLLRMIA   50 (369)
T ss_pred             EEECCCCCcHHHHHHHHh
Confidence            999999999999999864


No 408
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein.
Probab=90.91  E-value=0.16  Score=38.07  Aligned_cols=18  Identities=28%  Similarity=0.453  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~l~G~nGsGKSTLl~~i~   47 (237)
T TIGR00968        30 ALLGPSGSGKSTLLRIIA   47 (237)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999764


No 409
>PRK10762 D-ribose transporter ATP binding protein; Provisional
Probab=90.89  E-value=0.15  Score=42.40  Aligned_cols=18  Identities=33%  Similarity=0.492  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        34 ~l~G~NGsGKSTLl~~l~   51 (501)
T PRK10762         34 ALVGENGAGKSTMMKVLT   51 (501)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 410
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein. Members of this protein family are ABC transporter ATP-binding subunits, part of a three-gene putative bacteriocin transport operon. The other subunits include another ATP-binding subunit (TIGR03796), which has an N-terminal propeptide cleavage domain, and an HlyD homolog (TIGR03794). In a number of genomes, a conserved propeptide sequence with a classic Gly-Gly motif
Probab=90.89  E-value=0.16  Score=43.79  Aligned_cols=19  Identities=32%  Similarity=0.492  Sum_probs=17.1

Q ss_pred             cceEecCCCcHHHHHHhhh
Q 046733           86 TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +.|||..|.|||||++.+.
T Consensus       482 vaIvG~sGsGKSTLlklL~  500 (686)
T TIGR03797       482 VAIVGPSGSGKSTLLRLLL  500 (686)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            4999999999999999864


No 411
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D.  PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.89  E-value=0.17  Score=37.75  Aligned_cols=18  Identities=28%  Similarity=0.481  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        30 ~i~G~nGsGKSTLl~~l~   47 (232)
T cd03300          30 TLLGPSGCGKTTLLRLIA   47 (232)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999875


No 412
>PRK04841 transcriptional regulator MalT; Provisional
Probab=90.87  E-value=0.25  Score=43.04  Aligned_cols=33  Identities=21%  Similarity=0.436  Sum_probs=23.7

Q ss_pred             HHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHhh
Q 046733           71 RNKIINRLSALNDVDT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        71 ~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~V  103 (106)
                      +.+|++.|......++ -|.|++|.|||||+...
T Consensus        19 R~rl~~~l~~~~~~~~~~v~apaG~GKTtl~~~~   52 (903)
T PRK04841         19 RERLLAKLSGANNYRLVLVTSPAGYGKTTLISQW   52 (903)
T ss_pred             chHHHHHHhcccCCCeEEEECCCCCCHHHHHHHH
Confidence            3466666654333455 88899999999999764


No 413
>PRK13851 type IV secretion system protein VirB11; Provisional
Probab=90.86  E-value=0.32  Score=39.57  Aligned_cols=20  Identities=25%  Similarity=0.358  Sum_probs=17.3

Q ss_pred             cceEecCCCcHHHHHHhhhc
Q 046733           86 TVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      +-|.|..|.|||||++.+..
T Consensus       165 ilI~G~tGSGKTTll~aLl~  184 (344)
T PRK13851        165 MLLCGPTGSGKTTMSKTLIS  184 (344)
T ss_pred             EEEECCCCccHHHHHHHHHc
Confidence            48889999999999998754


No 414
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional
Probab=90.85  E-value=0.16  Score=39.52  Aligned_cols=18  Identities=28%  Similarity=0.484  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        69 ~I~G~nGsGKSTLl~~l~   86 (285)
T PRK14254         69 AMIGPSGCGKSTFLRCIN   86 (285)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999864


No 415
>PRK10416 signal recognition particle-docking protein FtsY; Provisional
Probab=90.83  E-value=0.16  Score=40.81  Aligned_cols=17  Identities=29%  Similarity=0.720  Sum_probs=15.5

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .++|..|.||||++..+
T Consensus       118 ~lvGpnGsGKTTt~~kL  134 (318)
T PRK10416        118 LVVGVNGVGKTTTIGKL  134 (318)
T ss_pred             EEECCCCCcHHHHHHHH
Confidence            88999999999999875


No 416
>PRK15064 ABC transporter ATP-binding protein; Provisional
Probab=90.81  E-value=0.16  Score=42.60  Aligned_cols=18  Identities=28%  Similarity=0.375  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        31 ~liG~NGsGKSTLl~~l~   48 (530)
T PRK15064         31 GLIGANGCGKSTFMKILG   48 (530)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999874


No 417
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional
Probab=90.76  E-value=0.29  Score=41.47  Aligned_cols=43  Identities=14%  Similarity=0.091  Sum_probs=32.9

Q ss_pred             ceeecchhHHHHHHHHhcCCC--CCcceEecCCCcHHHHHHhhhc
Q 046733           63 FAYGRDGDRNKIINRLSALND--VDTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        63 ~vvGrd~~~~~lv~~L~~~~~--~~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      .++|......++++.+..-..  ..+-|+|-.|.||++||+.++.
T Consensus       205 ~~ig~s~~~~~~~~~~~~~A~~~~pvlI~GE~GtGK~~lA~aiH~  249 (520)
T PRK10820        205 QIVAVSPKMRQVVEQARKLAMLDAPLLITGDTGTGKDLLAYACHL  249 (520)
T ss_pred             ceeECCHHHHHHHHHHHHHhCCCCCEEEECCCCccHHHHHHHHHH
Confidence            688888877888777743222  2348889999999999999864


No 418
>CHL00095 clpC Clp protease ATP binding subunit
Probab=90.71  E-value=0.23  Score=44.37  Aligned_cols=42  Identities=19%  Similarity=0.210  Sum_probs=31.6

Q ss_pred             CceeecchhHHHHHHHHhcCCC-----C-Cc---ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALND-----V-DT---VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~-----~-~~---~IvGmGGiGKTTLA~~V  103 (106)
                      ..|+|.++.++.|.+.+.....     . .+   -.+|..|+|||+||+.+
T Consensus       509 ~~v~GQ~~ai~~l~~~i~~~~~gl~~~~~p~~~~lf~Gp~GvGKt~lA~~L  559 (821)
T CHL00095        509 KRIIGQDEAVVAVSKAIRRARVGLKNPNRPIASFLFSGPTGVGKTELTKAL  559 (821)
T ss_pred             CcCcChHHHHHHHHHHHHHHhhcccCCCCCceEEEEECCCCCcHHHHHHHH
Confidence            4799999999999887753221     1 11   57799999999999864


No 419
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed
Probab=90.70  E-value=0.16  Score=41.96  Aligned_cols=19  Identities=37%  Similarity=0.307  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhhc
Q 046733           87 VIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy~  105 (106)
                      -|+|..|+|||+|++++.+
T Consensus       152 ~l~G~~G~GKThL~~ai~~  170 (450)
T PRK00149        152 FIYGGVGLGKTHLLHAIGN  170 (450)
T ss_pred             EEECCCCCCHHHHHHHHHH
Confidence            7789999999999998753


No 420
>TIGR00073 hypB hydrogenase accessory protein HypB. HypB is implicated in insertion of nickel into the large subunit of NiFe hydrogenases.
Probab=90.69  E-value=0.17  Score=37.31  Aligned_cols=18  Identities=17%  Similarity=0.283  Sum_probs=16.0

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .++|.-|.|||||.+.+.
T Consensus        26 ~~~G~~gsGKTTli~~l~   43 (207)
T TIGR00073        26 NFMSSPGSGKTTLIEKLI   43 (207)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            899999999999988753


No 421
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=90.68  E-value=0.17  Score=39.13  Aligned_cols=18  Identities=39%  Similarity=0.457  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        37 ~i~G~nGaGKSTLl~~i~   54 (279)
T PRK13635         37 AIVGHNGSGKSTLAKLLN   54 (279)
T ss_pred             EEECCCCCcHHHHHHHHh
Confidence            999999999999999874


No 422
>cd01855 YqeH YqeH.  YqeH is an essential GTP-binding protein. Depletion of YqeH induces an excess initiation of DNA replication, suggesting that it negatively controls initiation of chromosome replication. The YqeH subfamily is common in eukaryotes and sporadically present in bacteria with probable acquisition by plants from chloroplasts.  Proteins of the YqeH family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases.
Probab=90.68  E-value=0.32  Score=35.02  Aligned_cols=34  Identities=24%  Similarity=0.418  Sum_probs=22.4

Q ss_pred             HHHHHHHHhcC--CCCCcceEecCCCcHHHHHHhhh
Q 046733           71 RNKIINRLSAL--NDVDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        71 ~~~lv~~L~~~--~~~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +++|++.|...  ....+.++|+.|+|||||...+.
T Consensus       113 i~eL~~~l~~~l~~~~~~~~~G~~nvGKStliN~l~  148 (190)
T cd01855         113 VEELINAIKKLAKKGGDVYVVGATNVGKSTLINALL  148 (190)
T ss_pred             HHHHHHHHHHHhhcCCcEEEEcCCCCCHHHHHHHHH
Confidence            45555544331  11234899999999999988764


No 423
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional
Probab=90.61  E-value=0.17  Score=38.68  Aligned_cols=18  Identities=28%  Similarity=0.482  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        38 ~i~G~nGsGKSTLl~~l~   55 (261)
T PRK14263         38 GFIGPSGCGKSTVLRSLN   55 (261)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999999763


No 424
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=90.61  E-value=0.17  Score=42.57  Aligned_cols=19  Identities=26%  Similarity=0.494  Sum_probs=17.2

Q ss_pred             cceEecCCCcHHHHHHhhh
Q 046733           86 TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +.|||..|.|||||++.+.
T Consensus       379 vaIvG~SGsGKSTL~~lL~  397 (588)
T PRK11174        379 IALVGPSGAGKTSLLNALL  397 (588)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3999999999999999864


No 425
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=90.61  E-value=0.18  Score=38.90  Aligned_cols=18  Identities=33%  Similarity=0.390  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        37 ~I~G~nGsGKSTLl~~l~   54 (277)
T PRK13642         37 SIIGQNGSGKSTTARLID   54 (277)
T ss_pred             EEECCCCCcHHHHHHHHh
Confidence            999999999999999864


No 426
>cd03299 ABC_ModC_like Archeal protein closely related to ModC.  ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.61  E-value=0.18  Score=37.76  Aligned_cols=18  Identities=44%  Similarity=0.604  Sum_probs=16.4

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        29 ~i~G~nG~GKStLl~~l~   46 (235)
T cd03299          29 VILGPTGSGKSVLLETIA   46 (235)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999763


No 427
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=90.60  E-value=0.17  Score=39.30  Aligned_cols=18  Identities=28%  Similarity=0.523  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        37 ~i~G~nGsGKSTLl~~l~   54 (290)
T PRK13634         37 AIIGHTGSGKSTLLQHLN   54 (290)
T ss_pred             EEECCCCCcHHHHHHHHh
Confidence            999999999999999864


No 428
>PRK13549 xylose transporter ATP-binding subunit; Provisional
Probab=90.58  E-value=0.16  Score=42.22  Aligned_cols=18  Identities=22%  Similarity=0.481  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus       292 ~l~G~NGsGKSTLlk~i~  309 (506)
T PRK13549        292 GIAGLVGAGRTELVQCLF  309 (506)
T ss_pred             EEeCCCCCCHHHHHHHHh
Confidence            899999999999999875


No 429
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=90.57  E-value=0.17  Score=42.18  Aligned_cols=17  Identities=29%  Similarity=0.575  Sum_probs=14.8

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .++|.+|+||||++..+
T Consensus       225 ~~vGptGvGKTTt~~kL  241 (424)
T PRK05703        225 ALVGPTGVGKTTTLAKL  241 (424)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            88999999999987654


No 430
>PRK13549 xylose transporter ATP-binding subunit; Provisional
Probab=90.55  E-value=0.17  Score=42.18  Aligned_cols=18  Identities=28%  Similarity=0.412  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        35 ~l~G~nGsGKSTLl~~l~   52 (506)
T PRK13549         35 SLCGENGAGKSTLMKVLS   52 (506)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 431
>PRK09435 membrane ATPase/protein kinase; Provisional
Probab=90.53  E-value=0.33  Score=39.40  Aligned_cols=33  Identities=18%  Similarity=0.340  Sum_probs=21.9

Q ss_pred             HHHHHHHHhcCCCC--CcceEecCCCcHHHHHHhh
Q 046733           71 RNKIINRLSALNDV--DTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        71 ~~~lv~~L~~~~~~--~~~IvGmGGiGKTTLA~~V  103 (106)
                      ...|++.+......  .+.|.|..|.|||||...+
T Consensus        42 ~~~l~~~~~~~~~~~~~igi~G~~GaGKSTl~~~l   76 (332)
T PRK09435         42 AQELLDALLPHTGNALRIGITGVPGVGKSTFIEAL   76 (332)
T ss_pred             HHHHHHHHhhcCCCcEEEEEECCCCCCHHHHHHHH
Confidence            34555555332222  2399999999999999864


No 432
>TIGR00064 ftsY signal recognition particle-docking protein FtsY. There is a weak division between FtsY and SRP54; both are GTPases. In E.coli, ftsY is an essential gene located in an operon with cell division genes ftsE and ftsX, but its apparent function is as the signal recognition particle docking protein.
Probab=90.52  E-value=0.18  Score=39.53  Aligned_cols=17  Identities=29%  Similarity=0.692  Sum_probs=14.7

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .++|.+|+||||++..+
T Consensus        76 ~l~G~~G~GKTTt~akL   92 (272)
T TIGR00064        76 LFVGVNGVGKTTTIAKL   92 (272)
T ss_pred             EEECCCCCcHHHHHHHH
Confidence            78899999999987654


No 433
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2.  The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia.  Use of the term assembly of a functional ion channel implies the coming together of subunits or at least smaller not-yet functional components of the active whole.  In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells.  CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=90.50  E-value=0.18  Score=39.35  Aligned_cols=18  Identities=22%  Similarity=0.350  Sum_probs=16.9

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.++
T Consensus        34 ~IvG~nGsGKSTLl~~L~   51 (275)
T cd03289          34 GLLGRTGSGKSTLLSAFL   51 (275)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999875


No 434
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=90.49  E-value=0.17  Score=42.85  Aligned_cols=17  Identities=24%  Similarity=0.563  Sum_probs=15.8

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .++|.+|+||||++.++
T Consensus       245 ~LVGptGvGKTTTiaKL  261 (436)
T PRK11889        245 ALIGPTGVGKTTTLAKM  261 (436)
T ss_pred             EEECCCCCcHHHHHHHH
Confidence            89999999999999876


No 435
>PF01695 IstB_IS21:  IstB-like ATP binding protein;  InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif. They are found associated with IS21 family insertion sequences []. Functionally they have not been characterised, but they may be involved in transposition [].; GO: 0005524 ATP binding; PDB: 3EC2_A 3ECC_A 2W58_A 2QGZ_A.
Probab=90.49  E-value=0.22  Score=36.55  Aligned_cols=18  Identities=28%  Similarity=0.346  Sum_probs=16.2

Q ss_pred             cceEecCCCcHHHHHHhh
Q 046733           86 TVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~V  103 (106)
                      +-+.|..|+|||.||.++
T Consensus        50 l~l~G~~G~GKThLa~ai   67 (178)
T PF01695_consen   50 LILYGPPGTGKTHLAVAI   67 (178)
T ss_dssp             EEEEESTTSSHHHHHHHH
T ss_pred             EEEEhhHhHHHHHHHHHH
Confidence            488899999999999876


No 436
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional
Probab=90.46  E-value=0.18  Score=42.22  Aligned_cols=18  Identities=33%  Similarity=0.438  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        41 ~liG~NGsGKSTLl~~l~   58 (510)
T PRK15439         41 ALLGGNGAGKSTLMKIIA   58 (510)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 437
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional
Probab=90.43  E-value=0.17  Score=41.92  Aligned_cols=18  Identities=17%  Similarity=0.381  Sum_probs=16.9

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.++
T Consensus       278 ~l~G~nGsGKSTLl~~l~  295 (491)
T PRK10982        278 GIAGLVGAKRTDIVETLF  295 (491)
T ss_pred             EEecCCCCCHHHHHHHHc
Confidence            999999999999999875


No 438
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=90.42  E-value=0.17  Score=41.57  Aligned_cols=17  Identities=29%  Similarity=0.567  Sum_probs=15.8

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      ++.|..|+|||||-+.|
T Consensus        35 ~lLGPSGcGKTTlLR~I   51 (352)
T COG3842          35 TLLGPSGCGKTTLLRMI   51 (352)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            89999999999999876


No 439
>PRK15064 ABC transporter ATP-binding protein; Provisional
Probab=90.41  E-value=0.18  Score=42.28  Aligned_cols=18  Identities=28%  Similarity=0.650  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus       349 ~l~G~NGsGKSTLl~~i~  366 (530)
T PRK15064        349 AIIGENGVGKTTLLRTLV  366 (530)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999875


No 440
>PRK10261 glutathione transporter ATP-binding protein; Provisional
Probab=90.38  E-value=0.17  Score=43.51  Aligned_cols=18  Identities=39%  Similarity=0.451  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||++.+.
T Consensus        46 ~lvG~nGsGKSTLl~~l~   63 (623)
T PRK10261         46 AIVGESGSGKSVTALALM   63 (623)
T ss_pred             EEECCCCChHHHHHHHHH
Confidence            999999999999999874


No 441
>PRK09361 radB DNA repair and recombination protein RadB; Provisional
Probab=90.38  E-value=0.19  Score=37.17  Aligned_cols=18  Identities=28%  Similarity=0.309  Sum_probs=16.0

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      -|+|.+|.|||+||..+.
T Consensus        27 ~i~G~~GsGKT~l~~~la   44 (225)
T PRK09361         27 QIYGPPGSGKTNICLQLA   44 (225)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            899999999999998753


No 442
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter. This model describes ABC-type bacteriocin transporter. The amino terminal domain (pfam03412) processes the N-terminal leader peptide from the bacteriocin while C-terminal domains resemble ABC transporter membrane protein and ATP-binding cassette domain. In general, bacteriocins are agents which are responsible for killing or inhibiting the closely related species or even different strains of the same species. Bacteriocins are usually encoded by bacterial plasmids. Bacteriocins are named after the species and hence in literature one encounters various names e.g., leucocin from Leuconostic geldium; pedicocin from Pedicoccus acidilactici; sakacin from Lactobacillus sake etc.
Probab=90.36  E-value=0.17  Score=43.74  Aligned_cols=19  Identities=42%  Similarity=0.562  Sum_probs=17.1

Q ss_pred             cceEecCCCcHHHHHHhhh
Q 046733           86 TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +.|+|..|.|||||++.+.
T Consensus       503 vaIvG~SGsGKSTLlklL~  521 (708)
T TIGR01193       503 TTIVGMSGSGKSTLAKLLV  521 (708)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            4999999999999999863


No 443
>PRK08533 flagellar accessory protein FlaH; Reviewed
Probab=90.35  E-value=0.19  Score=38.18  Aligned_cols=16  Identities=25%  Similarity=0.343  Sum_probs=14.3

Q ss_pred             ceEecCCCcHHHHHHh
Q 046733           87 VIVGIGGLGKIVVWKN  102 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~  102 (106)
                      -|.|..|.||||||..
T Consensus        28 ~i~G~~G~GKTtl~~~   43 (230)
T PRK08533         28 LIEGDESTGKSILSQR   43 (230)
T ss_pred             EEECCCCCCHHHHHHH
Confidence            8899999999999744


No 444
>PRK09700 D-allose transporter ATP-binding protein; Provisional
Probab=90.32  E-value=0.18  Score=41.98  Aligned_cols=18  Identities=28%  Similarity=0.466  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        35 ~liG~nGsGKSTLl~~i~   52 (510)
T PRK09700         35 ALLGENGAGKSTLMKVLS   52 (510)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            999999999999999864


No 445
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional
Probab=90.31  E-value=0.18  Score=42.17  Aligned_cols=18  Identities=28%  Similarity=0.300  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus       316 ~i~G~nGsGKSTLlk~l~  333 (529)
T PRK15134        316 GLVGESGSGKSTTGLALL  333 (529)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999875


No 446
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional
Probab=90.28  E-value=0.18  Score=41.78  Aligned_cols=18  Identities=28%  Similarity=0.604  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        28 ~liG~nGsGKSTLl~~l~   45 (491)
T PRK10982         28 ALMGENGAGKSTLLKCLF   45 (491)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            999999999999999864


No 447
>PRK09700 D-allose transporter ATP-binding protein; Provisional
Probab=90.27  E-value=0.18  Score=41.93  Aligned_cols=18  Identities=17%  Similarity=0.425  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus       293 ~l~G~NGsGKSTLlk~i~  310 (510)
T PRK09700        293 GFAGLVGSGRTELMNCLF  310 (510)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 448
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional
Probab=90.26  E-value=0.18  Score=41.87  Aligned_cols=18  Identities=28%  Similarity=0.457  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        34 ~l~G~nGsGKSTLl~~l~   51 (501)
T PRK11288         34 ALMGENGAGKSTLLKILS   51 (501)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 449
>PRK13633 cobalt transporter ATP-binding subunit; Provisional
Probab=90.26  E-value=0.2  Score=38.70  Aligned_cols=18  Identities=39%  Similarity=0.580  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        40 ~l~G~nGsGKSTLl~~l~   57 (280)
T PRK13633         40 VILGRNGSGKSTIAKHMN   57 (280)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            899999999999999864


No 450
>PF05970 PIF1:  PIF1-like helicase;  InterPro: IPR010285  This entry represents PIF1 helicase and related proteins. The PIF1 helicase inhibits telomerase activity and is cell cycle regulated [, ]. 
Probab=90.21  E-value=0.35  Score=39.01  Aligned_cols=32  Identities=22%  Similarity=0.392  Sum_probs=21.3

Q ss_pred             HHHHHHhcCCCCCcceEecCCCcHHHHHHhhh
Q 046733           73 KIINRLSALNDVDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        73 ~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      .+++.+.......+-|.|.||.|||+|.+.+.
T Consensus        12 ~v~~~~~~~~~~~~fv~G~~GtGKs~l~~~i~   43 (364)
T PF05970_consen   12 TVIEAIENEEGLNFFVTGPAGTGKSFLIKAII   43 (364)
T ss_pred             HHHHHHHccCCcEEEEEcCCCCChhHHHHHHH
Confidence            33444433222233888999999999998764


No 451
>PLN02165 adenylate isopentenyltransferase
Probab=90.20  E-value=0.19  Score=41.12  Aligned_cols=17  Identities=35%  Similarity=0.511  Sum_probs=15.8

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .|+|+.|+||||||..+
T Consensus        47 vIiGPTGSGKStLA~~L   63 (334)
T PLN02165         47 VIMGATGSGKSRLSVDL   63 (334)
T ss_pred             EEECCCCCcHHHHHHHH
Confidence            99999999999999865


No 452
>cd03288 ABCC_SUR2 The SUR domain 2.  The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=90.19  E-value=0.21  Score=37.96  Aligned_cols=18  Identities=28%  Similarity=0.325  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        51 ~i~G~nGsGKSTLl~~l~   68 (257)
T cd03288          51 GICGRTGSGKSSLSLAFF   68 (257)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            899999999999999864


No 453
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional
Probab=90.17  E-value=0.19  Score=40.64  Aligned_cols=18  Identities=28%  Similarity=0.494  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        36 ~llGpsGsGKSTLLr~Ia   53 (351)
T PRK11432         36 TLLGPSGCGKTTVLRLVA   53 (351)
T ss_pred             EEECCCCCcHHHHHHHHH
Confidence            999999999999999864


No 454
>PF13555 AAA_29:  P-loop containing region of AAA domain
Probab=90.14  E-value=0.23  Score=31.28  Aligned_cols=18  Identities=33%  Similarity=0.488  Sum_probs=16.0

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|.|..|.|||||.-++.
T Consensus        27 li~G~nGsGKSTllDAi~   44 (62)
T PF13555_consen   27 LITGPNGSGKSTLLDAIQ   44 (62)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            889999999999988764


No 455
>PHA02244 ATPase-like protein
Probab=90.13  E-value=0.36  Score=40.31  Aligned_cols=21  Identities=24%  Similarity=0.185  Sum_probs=17.7

Q ss_pred             CcceEecCCCcHHHHHHhhhc
Q 046733           85 DTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        85 ~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      .+-|+|..|+|||+||+.+.+
T Consensus       121 PVLL~GppGtGKTtLA~aLA~  141 (383)
T PHA02244        121 PVFLKGGAGSGKNHIAEQIAE  141 (383)
T ss_pred             CEEEECCCCCCHHHHHHHHHH
Confidence            347889999999999998753


No 456
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR. At least five distinct pathways exists for the catabolism of propionate by way of propionyl-CoA. Members of this family represent the transcriptional regulatory protein PrpR, whose gene is found in most cases divergently transcribed from an operon for the methylcitric acid cycle of propionate catabolism. 2-methylcitric acid, a catabolite by this pathway, is a coactivator of PrpR.
Probab=90.10  E-value=0.36  Score=41.36  Aligned_cols=43  Identities=19%  Similarity=0.200  Sum_probs=34.2

Q ss_pred             ceeecchhHHHHHHHHhcCCC--CCcceEecCCCcHHHHHHhhhc
Q 046733           63 FAYGRDGDRNKIINRLSALND--VDTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        63 ~vvGrd~~~~~lv~~L~~~~~--~~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      +++|.......+.+.+..-..  ..+-|.|-.|.||+.+|+.+|+
T Consensus       213 ~iiG~S~~m~~~~~~i~~~A~~~~pVLI~GE~GTGKe~lA~~IH~  257 (526)
T TIGR02329       213 DLLGASAPMEQVRALVRLYARSDATVLILGESGTGKELVAQAIHQ  257 (526)
T ss_pred             heeeCCHHHHHHHHHHHHHhCCCCcEEEECCCCcCHHHHHHHHHH
Confidence            599999888888887754322  2458889999999999999985


No 457
>PRK10762 D-ribose transporter ATP binding protein; Provisional
Probab=90.09  E-value=0.19  Score=41.73  Aligned_cols=18  Identities=28%  Similarity=0.543  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus       282 ~liG~NGsGKSTLl~~l~  299 (501)
T PRK10762        282 GVSGLMGAGRTELMKVLY  299 (501)
T ss_pred             EEecCCCCCHHHHHHHHh
Confidence            899999999999999875


No 458
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional
Probab=90.07  E-value=0.19  Score=42.04  Aligned_cols=18  Identities=22%  Similarity=0.532  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus       293 ~l~G~NGsGKSTLl~~i~  310 (510)
T PRK15439        293 GLAGVVGAGRTELAETLY  310 (510)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            999999999999999874


No 459
>PLN03071 GTP-binding nuclear protein Ran; Provisional
Probab=90.06  E-value=0.22  Score=37.10  Aligned_cols=19  Identities=47%  Similarity=0.574  Sum_probs=16.6

Q ss_pred             CcceEecCCCcHHHHHHhh
Q 046733           85 DTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        85 ~~~IvGmGGiGKTTLA~~V  103 (106)
                      ++.|+|..|+|||||....
T Consensus        15 Ki~vvG~~gvGKTsli~~~   33 (219)
T PLN03071         15 KLVIVGDGGTGKTTFVKRH   33 (219)
T ss_pred             EEEEECcCCCCHHHHHHHH
Confidence            4589999999999999864


No 460
>PRK07952 DNA replication protein DnaC; Validated
Probab=90.01  E-value=0.2  Score=38.84  Aligned_cols=18  Identities=28%  Similarity=0.322  Sum_probs=16.2

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      -++|-+|.|||+||.++.
T Consensus       103 ~l~G~~GtGKThLa~aia  120 (244)
T PRK07952        103 IFSGKPGTGKNHLAAAIC  120 (244)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            788999999999999864


No 461
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=90.01  E-value=0.18  Score=37.81  Aligned_cols=14  Identities=43%  Similarity=0.648  Sum_probs=13.5

Q ss_pred             ceEecCCCcHHHHH
Q 046733           87 VIVGIGGLGKIVVW  100 (106)
Q Consensus        87 ~IvGmGGiGKTTLA  100 (106)
                      .|+|..|.|||||+
T Consensus        25 ~l~G~sGsGKSTL~   38 (226)
T cd03270          25 VITGVSGSGKSSLA   38 (226)
T ss_pred             EEEcCCCCCHHHHH
Confidence            99999999999996


No 462
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.
Probab=89.98  E-value=0.43  Score=43.08  Aligned_cols=42  Identities=21%  Similarity=0.326  Sum_probs=32.0

Q ss_pred             CceeecchhHHHHHHHHhcCC------CC--Cc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKIINRLSALN------DV--DT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~------~~--~~-~IvGmGGiGKTTLA~~V  103 (106)
                      ..|+|.++.++.|.+.+....      ..  .+ -.+|..|+|||.||+.+
T Consensus       566 ~~v~GQ~~Av~~v~~~i~~~~~gl~~~~~p~~~~lf~Gp~GvGKT~lA~~L  616 (852)
T TIGR03345       566 ERVIGQDHALEAIAERIRTARAGLEDPRKPLGVFLLVGPSGVGKTETALAL  616 (852)
T ss_pred             CeEcChHHHHHHHHHHHHHHhcCCCCCCCCceEEEEECCCCCCHHHHHHHH
Confidence            479999999999988875421      11  12 66799999999999864


No 463
>PRK10261 glutathione transporter ATP-binding protein; Provisional
Probab=89.98  E-value=0.2  Score=43.13  Aligned_cols=18  Identities=28%  Similarity=0.431  Sum_probs=16.8

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus       354 ~lvG~nGsGKSTLlk~i~  371 (623)
T PRK10261        354 SLVGESGSGKSTTGRALL  371 (623)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999999874


No 464
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed
Probab=89.98  E-value=0.2  Score=42.39  Aligned_cols=18  Identities=39%  Similarity=0.558  Sum_probs=16.9

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus       354 ~l~G~NGsGKSTLl~~i~  371 (556)
T PRK11819        354 GIIGPNGAGKSTLFKMIT  371 (556)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999875


No 465
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein. This protein describes an multidomain ABC transporter subunit that is one of three protein families associated with some regularity with a distinctive family of putative bacteriocins. It includes a bacteriocin-processing peptidase domain at the N-terminus. Model TIGR03793 describes a conserved propeptide region for this bacteriocin family, unusual because it shows obvious homology a region of the enzyme nitrile hydratase up to the classic Gly-Gly cleavage motif. This family is therefore predicted to be a subunit of a bacteriocin processing and export system characteristic to this system that we designate NHPM, Nitrile Hydratase Propeptide Microcin.
Probab=89.97  E-value=0.19  Score=43.38  Aligned_cols=19  Identities=32%  Similarity=0.385  Sum_probs=17.1

Q ss_pred             cceEecCCCcHHHHHHhhh
Q 046733           86 TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +.|||..|.|||||++.+.
T Consensus       508 vaIvG~sGsGKSTLlklL~  526 (710)
T TIGR03796       508 VALVGGSGSGKSTIAKLVA  526 (710)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            4999999999999999863


No 466
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]
Probab=89.97  E-value=0.21  Score=39.73  Aligned_cols=17  Identities=35%  Similarity=0.540  Sum_probs=16.0

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .|+|..|.|||||.+.+
T Consensus        61 ~I~G~NGsGKTTLL~ll   77 (257)
T COG1119          61 AIVGPNGAGKTTLLSLL   77 (257)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            99999999999999875


No 467
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional
Probab=89.96  E-value=0.37  Score=41.53  Aligned_cols=44  Identities=16%  Similarity=0.160  Sum_probs=34.7

Q ss_pred             CceeecchhHHHHHHHHhcCCC--CCcceEecCCCcHHHHHHhhhc
Q 046733           62 KFAYGRDGDRNKIINRLSALND--VDTVIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        62 ~~vvGrd~~~~~lv~~L~~~~~--~~~~IvGmGGiGKTTLA~~Vy~  105 (106)
                      .+++|.....+.+.+.+..-..  ..+-|.|-.|.||+++|+.+++
T Consensus       219 ~~iiG~S~~m~~~~~~i~~~A~s~~pVLI~GE~GTGKe~~A~~IH~  264 (538)
T PRK15424        219 GDLLGQSPQMEQVRQTILLYARSSAAVLIQGETGTGKELAAQAIHR  264 (538)
T ss_pred             hheeeCCHHHHHHHHHHHHHhCCCCcEEEECCCCCCHHHHHHHHHH
Confidence            3599999888888887754322  2458889999999999999975


No 468
>cd01858 NGP_1 NGP-1.  Autoantigen NGP-1 (Nucleolar G-protein gene 1) has been shown to localize in the nucleolus and nucleolar organizers in all cell types analyzed, which is indicative of a function in ribosomal assembly. NGP-1 and its homologs show a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with NKXD motif) are relocated to the N terminus.
Probab=89.95  E-value=0.25  Score=34.55  Aligned_cols=18  Identities=17%  Similarity=0.333  Sum_probs=16.0

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .++|+.|+||+||-..+.
T Consensus       106 ~~~G~~nvGKStliN~l~  123 (157)
T cd01858         106 GFIGYPNVGKSSIINTLR  123 (157)
T ss_pred             EEEeCCCCChHHHHHHHh
Confidence            789999999999988764


No 469
>PRK12377 putative replication protein; Provisional
Probab=89.95  E-value=0.21  Score=38.89  Aligned_cols=19  Identities=32%  Similarity=0.211  Sum_probs=16.8

Q ss_pred             cceEecCCCcHHHHHHhhh
Q 046733           86 TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +-++|..|+|||.||.++.
T Consensus       104 l~l~G~~GtGKThLa~AIa  122 (248)
T PRK12377        104 FVFSGKPGTGKNHLAAAIG  122 (248)
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            3788999999999999875


No 470
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional
Probab=89.93  E-value=0.2  Score=42.31  Aligned_cols=17  Identities=29%  Similarity=0.423  Sum_probs=15.4

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .++|.+|+||||++..+
T Consensus       227 ~lvGptGvGKTTtaaKL  243 (432)
T PRK12724        227 FFVGPTGSGKTTSIAKL  243 (432)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            78899999999999875


No 471
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=89.93  E-value=0.21  Score=37.37  Aligned_cols=18  Identities=39%  Similarity=0.514  Sum_probs=16.4

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||-+++.
T Consensus        29 ~ivGpNGaGKSTll~~i~   46 (212)
T cd03274          29 AIVGPNGSGKSNVIDSML   46 (212)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            999999999999998764


No 472
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.
Probab=89.91  E-value=0.21  Score=41.67  Aligned_cols=18  Identities=44%  Similarity=0.479  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus       314 ~l~G~NGsGKSTLl~~l~  331 (520)
T TIGR03269       314 GIVGTSGAGKTTLSKIIA  331 (520)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999874


No 473
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional
Probab=89.90  E-value=0.22  Score=41.84  Aligned_cols=19  Identities=21%  Similarity=0.254  Sum_probs=17.1

Q ss_pred             cceEecCCCcHHHHHHhhh
Q 046733           86 TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +.|+|..|.|||||++.+.
T Consensus       352 ~aivG~sGsGKSTL~~ll~  370 (547)
T PRK10522        352 LFLIGGNGSGKSTLAMLLT  370 (547)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3999999999999999864


No 474
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional
Probab=89.90  E-value=0.21  Score=39.90  Aligned_cols=18  Identities=28%  Similarity=0.538  Sum_probs=17.0

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.++
T Consensus       112 ~IvG~~GsGKSTLl~~L~  129 (329)
T PRK14257        112 AFIGPSGCGKSTFLRNLN  129 (329)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999876


No 475
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional
Probab=89.89  E-value=0.2  Score=41.36  Aligned_cols=18  Identities=39%  Similarity=0.446  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus       290 ~i~G~NGsGKSTLl~~l~  307 (490)
T PRK10938        290 QIVGPNGAGKSTLLSLIT  307 (490)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            899999999999999874


No 476
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]
Probab=89.89  E-value=0.22  Score=38.71  Aligned_cols=19  Identities=37%  Similarity=0.524  Sum_probs=17.6

Q ss_pred             ceEecCCCcHHHHHHhhhc
Q 046733           87 VIVGIGGLGKIVVWKNIYW  105 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy~  105 (106)
                      -|+|..|.|||||-+++|-
T Consensus        32 fl~GpSGAGKSTllkLi~~   50 (223)
T COG2884          32 FLTGPSGAGKSTLLKLIYG   50 (223)
T ss_pred             EEECCCCCCHHHHHHHHHh
Confidence            8999999999999999883


No 477
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional
Probab=89.89  E-value=0.21  Score=38.09  Aligned_cols=17  Identities=35%  Similarity=0.474  Sum_probs=16.0

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .|+|..|.|||||.+.+
T Consensus        40 ~i~G~nGsGKSTLl~~i   56 (257)
T PRK14246         40 GIMGPSGSGKSTLLKVL   56 (257)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            99999999999999976


No 478
>PLN03118 Rab family protein; Provisional
Probab=89.89  E-value=0.22  Score=36.30  Aligned_cols=19  Identities=21%  Similarity=0.483  Sum_probs=16.5

Q ss_pred             CcceEecCCCcHHHHHHhh
Q 046733           85 DTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        85 ~~~IvGmGGiGKTTLA~~V  103 (106)
                      ++.|+|-.|+|||||...+
T Consensus        16 kv~ivG~~~vGKTsli~~l   34 (211)
T PLN03118         16 KILLIGDSGVGKSSLLVSF   34 (211)
T ss_pred             EEEEECcCCCCHHHHHHHH
Confidence            4589999999999999765


No 479
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion.
Probab=89.77  E-value=0.23  Score=41.62  Aligned_cols=19  Identities=32%  Similarity=0.415  Sum_probs=17.1

Q ss_pred             cceEecCCCcHHHHHHhhh
Q 046733           86 TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +.|+|..|.|||||++.+.
T Consensus       347 ~~ivG~sGsGKSTL~~ll~  365 (544)
T TIGR01842       347 LAIIGPSGSGKSTLARLIV  365 (544)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3999999999999999864


No 480
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional
Probab=89.76  E-value=0.22  Score=40.29  Aligned_cols=18  Identities=28%  Similarity=0.475  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        32 ~llGpsGsGKSTLLr~Ia   49 (353)
T PRK10851         32 ALLGPSGSGKTTLLRIIA   49 (353)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999864


No 481
>cd01393 recA_like RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57.  Archaea have the RecA-like homologs radA and radB.
Probab=89.72  E-value=0.22  Score=36.51  Aligned_cols=19  Identities=26%  Similarity=0.254  Sum_probs=16.6

Q ss_pred             Cc-ceEecCCCcHHHHHHhh
Q 046733           85 DT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        85 ~~-~IvGmGGiGKTTLA~~V  103 (106)
                      .+ .|+|..|.|||+||..+
T Consensus        20 ~v~~I~G~~GsGKT~l~~~i   39 (226)
T cd01393          20 RITEIFGEFGSGKTQLCLQL   39 (226)
T ss_pred             cEEEEeCCCCCChhHHHHHH
Confidence            45 99999999999999865


No 482
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]
Probab=89.66  E-value=0.57  Score=35.67  Aligned_cols=41  Identities=10%  Similarity=0.033  Sum_probs=30.6

Q ss_pred             ceeecchhHHHHHHHHhcCC-CCC-cceEecCCCcHHHHHHhh
Q 046733           63 FAYGRDGDRNKIINRLSALN-DVD-TVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        63 ~vvGrd~~~~~lv~~L~~~~-~~~-~~IvGmGGiGKTTLA~~V  103 (106)
                      +++|.+.....+..+..... -.. +=+.|..|+||||+|..+
T Consensus         2 ~~~~~~~~~~~l~~~~~~~~~~~halL~~Gp~G~Gktt~a~~l   44 (325)
T COG0470           2 ELVPWQEAVKRLLVQALESGRLPHALLFYGPPGVGKTTAALAL   44 (325)
T ss_pred             CcccchhHHHHHHHHHHhcCCCCceeeeeCCCCCCHHHHHHHH
Confidence            46777888888888887433 223 367799999999999753


No 483
>PRK03003 GTP-binding protein Der; Reviewed
Probab=89.63  E-value=0.38  Score=40.06  Aligned_cols=19  Identities=26%  Similarity=0.417  Sum_probs=16.6

Q ss_pred             cceEecCCCcHHHHHHhhh
Q 046733           86 TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +.|+|..|+|||||...+.
T Consensus        41 V~IvG~~nvGKSSL~nrl~   59 (472)
T PRK03003         41 VAVVGRPNVGKSTLVNRIL   59 (472)
T ss_pred             EEEEcCCCCCHHHHHHHHh
Confidence            4999999999999998653


No 484
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=89.59  E-value=0.22  Score=41.12  Aligned_cols=17  Identities=24%  Similarity=0.485  Sum_probs=15.5

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .++|..|+||||++.++
T Consensus       141 ~lvGptGvGKTTtiakL  157 (374)
T PRK14722        141 ALMGPTGVGKTTTTAKL  157 (374)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            88999999999998875


No 485
>PLN02674 adenylate kinase
Probab=89.58  E-value=0.23  Score=38.67  Aligned_cols=18  Identities=28%  Similarity=0.292  Sum_probs=16.1

Q ss_pred             cceEecCCCcHHHHHHhh
Q 046733           86 TVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~V  103 (106)
                      +-|.|+.|.||+|+|+.+
T Consensus        34 i~l~G~PGsGKgT~a~~L   51 (244)
T PLN02674         34 LILIGPPGSGKGTQSPII   51 (244)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            478899999999999975


No 486
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional
Probab=89.58  E-value=0.23  Score=40.23  Aligned_cols=18  Identities=33%  Similarity=0.549  Sum_probs=16.4

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+-
T Consensus        34 ~llG~sGsGKSTLLr~ia   51 (356)
T PRK11650         34 VLVGPSGCGKSTLLRMVA   51 (356)
T ss_pred             EEECCCCCcHHHHHHHHH
Confidence            899999999999999763


No 487
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family. Members of this protein family have two copies of the ABC transporter ATP-binding cassette, but are found outside the common ABC transporter operon structure that features integral membrane permease proteins and substrate-binding proteins encoded next to the ATP-binding cassette (ABC domain) protein. The member protein ChvD from Agrobacterium tumefaciens was identified as both a candidate to interact with VirB8, based on yeast two-hybrid analysis, and as an apparent regulator of VirG. The general function of this protein family is unknown.
Probab=89.57  E-value=0.22  Score=42.07  Aligned_cols=18  Identities=28%  Similarity=0.532  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus       352 ~l~G~NGsGKSTLl~~l~  369 (552)
T TIGR03719       352 GVIGPNGAGKSTLFRMIT  369 (552)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            999999999999999874


No 488
>PF02562 PhoH:  PhoH-like protein;  InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [].; GO: 0005524 ATP binding; PDB: 3B85_A.
Probab=89.56  E-value=0.26  Score=37.58  Aligned_cols=35  Identities=17%  Similarity=0.263  Sum_probs=21.1

Q ss_pred             eecchhHHHHHHHHhcCCCCCc-ceEecCCCcHHHHHHh
Q 046733           65 YGRDGDRNKIINRLSALNDVDT-VIVGIGGLGKIVVWKN  102 (106)
Q Consensus        65 vGrd~~~~~lv~~L~~~~~~~~-~IvGmGGiGKTTLA~~  102 (106)
                      ..+.......++.|..   .++ .+.|..|.|||.||-.
T Consensus         3 ~p~~~~Q~~~~~al~~---~~~v~~~G~AGTGKT~LA~a   38 (205)
T PF02562_consen    3 KPKNEEQKFALDALLN---NDLVIVNGPAGTGKTFLALA   38 (205)
T ss_dssp             ---SHHHHHHHHHHHH----SEEEEE--TTSSTTHHHHH
T ss_pred             cCCCHHHHHHHHHHHh---CCeEEEECCCCCcHHHHHHH
Confidence            3455556666777762   233 7889999999999864


No 489
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=89.55  E-value=0.23  Score=39.33  Aligned_cols=17  Identities=35%  Similarity=0.456  Sum_probs=16.0

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      .|.|+.|.||+|||..+
T Consensus        34 aiMGPNGsGKSTLa~~i   50 (251)
T COG0396          34 AIMGPNGSGKSTLAYTI   50 (251)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            99999999999999875


No 490
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]
Probab=89.54  E-value=0.2  Score=45.37  Aligned_cols=17  Identities=35%  Similarity=0.538  Sum_probs=15.0

Q ss_pred             ceEecCCCcHHHHHHhh
Q 046733           87 VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~V  103 (106)
                      -++|..|+||||||..|
T Consensus       330 LL~GppGlGKTTLAHVi  346 (877)
T KOG1969|consen  330 LLCGPPGLGKTTLAHVI  346 (877)
T ss_pred             EeecCCCCChhHHHHHH
Confidence            67799999999999865


No 491
>PLN00223 ADP-ribosylation factor; Provisional
Probab=89.53  E-value=0.25  Score=35.50  Aligned_cols=20  Identities=20%  Similarity=0.444  Sum_probs=17.2

Q ss_pred             CcceEecCCCcHHHHHHhhh
Q 046733           85 DTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        85 ~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      ++.|+|..|+|||||...+.
T Consensus        19 ki~ivG~~~~GKTsl~~~l~   38 (181)
T PLN00223         19 RILMVGLDAAGKTTILYKLK   38 (181)
T ss_pred             EEEEECCCCCCHHHHHHHHc
Confidence            45999999999999998764


No 492
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldA is an ABC transporter ATP-binding protein (pfam00005) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldA abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Probab=89.52  E-value=0.24  Score=38.77  Aligned_cols=18  Identities=33%  Similarity=0.350  Sum_probs=16.5

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        32 ~l~G~NGaGKTTLl~~l~   49 (301)
T TIGR03522        32 GFLGPNGAGKSTTMKIIT   49 (301)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999764


No 493
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit. Unfortunately, the gene symbol nomenclature adopted based on this operon in B. subtilis assigns cydC to the third gene in the operon where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologs in this family in accordance with the precedence of publication of the E. coli name, CydD
Probab=89.52  E-value=0.25  Score=41.13  Aligned_cols=19  Identities=26%  Similarity=0.454  Sum_probs=17.1

Q ss_pred             cceEecCCCcHHHHHHhhh
Q 046733           86 TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +.|+|..|.|||||++.+.
T Consensus       351 ~~ivG~sGsGKSTL~~ll~  369 (529)
T TIGR02857       351 VALVGPSGAGKSTLLNLLL  369 (529)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3999999999999999864


No 494
>PF06068 TIP49:  TIP49 C-terminus;  InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins. The N-terminal domain contains the AAA ATPase, central region IPR003959 from INTERPRO domain. In zebrafish, the liebeskummer (lik) mutation, causes development of hyperplastic embryonic hearts. lik encodes Reptin, a component of a DNA-stimulated ATPase complex. Beta-catenin and Pontin, a DNA-stimulated ATPase that is often part of complexes with Reptin, are in the same genetic pathways. The Reptin/Pontin ratio serves to regulate heart growth during development, at least in part via the beta-catenin pathway []. TBP-interacting protein 49 (TIP49) was originally identified as a TBP-binding protein, and two related proteins are encoded by individual genes, tip49a and b. Although the function of this gene family has not been elucidated, they are supposed to play a critical role in nuclear events because they interact with various kinds of nuclear factors and have DNA helicase activities. TIP49a has been suggested to act as an autoantigen in some patients with autoimmune diseases [].; GO: 0003678 DNA helicase activity, 0005524 ATP binding; PDB: 2XSZ_E 2CQA_A 2C9O_C.
Probab=89.49  E-value=0.6  Score=39.22  Aligned_cols=42  Identities=19%  Similarity=0.238  Sum_probs=27.5

Q ss_pred             CceeecchhHHHH---HHHHhcCCCC-Cc-ceEecCCCcHHHHHHhh
Q 046733           62 KFAYGRDGDRNKI---INRLSALNDV-DT-VIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        62 ~~vvGrd~~~~~l---v~~L~~~~~~-~~-~IvGmGGiGKTTLA~~V  103 (106)
                      ..+||..+.++..   ++++....-. +. -++|..|.|||+||-.+
T Consensus        24 ~GlVGQ~~AReAagiiv~mIk~~K~aGr~iLiaGppGtGKTAlA~~i   70 (398)
T PF06068_consen   24 DGLVGQEKAREAAGIIVDMIKEGKIAGRAILIAGPPGTGKTALAMAI   70 (398)
T ss_dssp             TTEES-HHHHHHHHHHHHHHHTT--TT-EEEEEE-TTSSHHHHHHHH
T ss_pred             ccccChHHHHHHHHHHHHHHhcccccCcEEEEeCCCCCCchHHHHHH
Confidence            4799998777653   5555544322 33 88899999999999865


No 495
>COG1855 ATPase (PilT family) [General function prediction only]
Probab=89.47  E-value=0.3  Score=42.44  Aligned_cols=33  Identities=24%  Similarity=0.331  Sum_probs=23.9

Q ss_pred             HHHHHHHHhcCCCCCcceEecCCCcHHHHHHhhh
Q 046733           71 RNKIINRLSALNDVDTVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        71 ~~~lv~~L~~~~~~~~~IvGmGGiGKTTLA~~Vy  104 (106)
                      -++|.+.|.... ..+-|-|..|.||||.||++-
T Consensus       252 ~dkl~eRL~era-eGILIAG~PGaGKsTFaqAlA  284 (604)
T COG1855         252 SDKLKERLEERA-EGILIAGAPGAGKSTFAQALA  284 (604)
T ss_pred             CHHHHHHHHhhh-cceEEecCCCCChhHHHHHHH
Confidence            356777765432 234677999999999999874


No 496
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]
Probab=89.45  E-value=0.25  Score=38.89  Aligned_cols=18  Identities=33%  Similarity=0.602  Sum_probs=16.9

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      +++|..|.|||||.+.++
T Consensus        33 ~llG~NGaGKTTlLkti~   50 (237)
T COG0410          33 ALLGRNGAGKTTLLKTIM   50 (237)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999875


No 497
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional
Probab=89.40  E-value=0.23  Score=41.09  Aligned_cols=18  Identities=33%  Similarity=0.582  Sum_probs=16.6

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        58 ~LvG~NGsGKSTLLr~I~   75 (400)
T PRK10070         58 VIMGLSGSGKSTMVRLLN   75 (400)
T ss_pred             EEECCCCchHHHHHHHHH
Confidence            899999999999999874


No 498
>PRK10636 putative ABC transporter ATP-binding protein; Provisional
Probab=89.38  E-value=0.23  Score=43.00  Aligned_cols=19  Identities=26%  Similarity=0.340  Sum_probs=17.0

Q ss_pred             cceEecCCCcHHHHHHhhh
Q 046733           86 TVIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        86 ~~IvGmGGiGKTTLA~~Vy  104 (106)
                      +.|+|..|.|||||.+.+.
T Consensus        30 v~LvG~NGsGKSTLLkiL~   48 (638)
T PRK10636         30 VGLVGKNGCGKSTLLALLK   48 (638)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3999999999999999864


No 499
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed
Probab=89.37  E-value=0.24  Score=41.93  Aligned_cols=18  Identities=22%  Similarity=0.484  Sum_probs=16.7

Q ss_pred             ceEecCCCcHHHHHHhhh
Q 046733           87 VIVGIGGLGKIVVWKNIY  104 (106)
Q Consensus        87 ~IvGmGGiGKTTLA~~Vy  104 (106)
                      .|+|..|.|||||.+.+.
T Consensus        37 ~iiG~NGsGKSTLlk~i~   54 (556)
T PRK11819         37 GVLGLNGAGKSTLLRIMA   54 (556)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            999999999999999874


No 500
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis]
Probab=89.34  E-value=0.24  Score=43.23  Aligned_cols=19  Identities=32%  Similarity=0.531  Sum_probs=17.1

Q ss_pred             CcceEecCCCcHHHHHHhh
Q 046733           85 DTVIVGIGGLGKIVVWKNI  103 (106)
Q Consensus        85 ~~~IvGmGGiGKTTLA~~V  103 (106)
                      ++.+||..|+|||||.+++
T Consensus       108 RYGLvGrNG~GKsTLLRai  126 (582)
T KOG0062|consen  108 RYGLVGRNGIGKSTLLRAI  126 (582)
T ss_pred             ccceeCCCCCcHHHHHHHH
Confidence            4599999999999999976


Done!