BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 046768
(314 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3C9R|A Chain A, Aathil Complexed With Atp
pdb|3C9R|B Chain B, Aathil Complexed With Atp
pdb|3C9S|A Chain A, Aathil Complexed With Amppcp
pdb|3C9S|B Chain B, Aathil Complexed With Amppcp
pdb|3C9T|A Chain A, Aathil Complexed With Amppcp And Tmp
pdb|3C9T|B Chain B, Aathil Complexed With Amppcp And Tmp
pdb|3C9U|A Chain A, Aathil Complexed With Adp And Tpp
pdb|3C9U|B Chain B, Aathil Complexed With Adp And Tpp
Length = 342
Score = 28.5 bits (62), Expect = 5.7, Method: Compositional matrix adjust.
Identities = 14/45 (31%), Positives = 25/45 (55%)
Query: 160 LGWKIIAWIFSDIVFDWGLLNWHSKNCWLRDKLLVPHKSVYFIGM 204
+GWK I+ SD++ + GL W + L + L V + ++IG+
Sbjct: 96 VGWKAISVNVSDVIANGGLPKWALISLNLPEDLEVSYVERFYIGV 140
>pdb|1VQV|A Chain A, Crystal Structure Of Thiamine Monophosphate Kinase (Thil)
From Aquifex Aeolicus
pdb|1VQV|B Chain B, Crystal Structure Of Thiamine Monophosphate Kinase (Thil)
From Aquifex Aeolicus
Length = 306
Score = 28.1 bits (61), Expect = 6.9, Method: Compositional matrix adjust.
Identities = 14/45 (31%), Positives = 25/45 (55%)
Query: 160 LGWKIIAWIFSDIVFDWGLLNWHSKNCWLRDKLLVPHKSVYFIGM 204
+GWK I+ SD++ + GL W + L + L V + ++IG+
Sbjct: 60 VGWKAISVNVSDVIANGGLPKWALISLNLPEDLEVSYVERFYIGV 104
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.328 0.139 0.432
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,320,681
Number of Sequences: 62578
Number of extensions: 306010
Number of successful extensions: 647
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 645
Number of HSP's gapped (non-prelim): 2
length of query: 314
length of database: 14,973,337
effective HSP length: 99
effective length of query: 215
effective length of database: 8,778,115
effective search space: 1887294725
effective search space used: 1887294725
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)