Citrus Sinensis ID: 046813


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250
MEGDGDNNNNMGMVSGGGGGGGGGTTLSSSSRWNPTKEQINMLESLYAQGIRTPSAEQIQQITTRLRAYGHIEGKNVFYWFQNHKARQRQKQKQERTAFINRYLHKSAHQPAPLFPPSTNVVCGPYYLPRNDLGFYPQCTKVLIPGGSKMRAKTDQEMDKTTSYVGAGYDPEQPECNVMMHTSNINNSDISNQETLPLFPLHPTGILQAKTNAMLPSNSLENSITPCIEKDPADQPFFDFFSGQGCERTD
ccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccEEEcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccc
***********************************TKEQINMLESLYAQGIRTPSAEQIQQITTRLRAYGHIEGKNVFYWFQNH***************************************************************************************************************LPLFPLHPTGI******************************FFDFF**Q******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGDGDNNNNMGMVSGGGGGGGGGTTLSSSSRWNPTKEQINMLESLYAQGIRTPSAEQIQQITTRLRAYGHIEGKNVFYWFQNHKARQRQKQKQERTAFINRYLHKSAHQPAPLFPPSTNVVCGPYYLPRNDLGFYPQCTKVLIPGGSKMRAKTDQEMDKTTSYVGAGYDPEQPECNVMMHTSNINNSDISNQETLPLFPLHPTGILQAKTNAMLPSNSLENSITPCIEKDPADQPFFDFFSGQGCERTD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
WUSCHEL-related homeobox 2 Probable transcription factor involved in embryonic patterning. Required for apical embryo development after fertilization. Its specific localization to the apical daughter cell of the zygote, while WOX8 is confined to the basal cell, suggests that the asymmetric division of the plant zygote separates determinants of apical and basal cell fates.probableQ6X7K1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CUF, chain A
Confidence level:confident
Coverage over the Query: 25-94
View the alignment between query and template
View the model in PyMOL
Template: 1B72, chain A
Confidence level:confident
Coverage over the Query: 4-12,31-93
View the alignment between query and template
View the model in PyMOL