BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046816
         (96 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q2T9I9|F208A_XENLA Protein FAM208A OS=Xenopus laevis GN=fam208a PE=2 SV=1
          Length = 1555

 Score = 30.0 bits (66), Expect = 4.0,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 6/67 (8%)

Query: 13  SASAPPQFYLDEKWKLSKKEGSSRSRSSSSSTTTAF------IKSASTSARRRCSFSRKC 66
           +   PP+     ++++ +K    R+    SS +  F      + S+   A  + SFS KC
Sbjct: 50  TGQKPPEEAPRRRFQIPRKSRDKRALQVISSGSREFEEILKILHSSYLDANSKASFSYKC 109

Query: 67  ARLVREQ 73
           ARLV  +
Sbjct: 110 ARLVHNE 116


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.321    0.121    0.360 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 26,885,700
Number of Sequences: 539616
Number of extensions: 658139
Number of successful extensions: 6775
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 35
Number of HSP's successfully gapped in prelim test: 27
Number of HSP's that attempted gapping in prelim test: 6118
Number of HSP's gapped (non-prelim): 664
length of query: 96
length of database: 191,569,459
effective HSP length: 66
effective length of query: 30
effective length of database: 155,954,803
effective search space: 4678644090
effective search space used: 4678644090
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 55 (25.8 bits)