BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 046820
         (350 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3CE9|A Chain A, Crystal Structure Of Glycerol Dehydrogenase (Np_348253.1)
           From Clostridium Acetobutylicum At 2.37 A Resolution
 pdb|3CE9|B Chain B, Crystal Structure Of Glycerol Dehydrogenase (Np_348253.1)
           From Clostridium Acetobutylicum At 2.37 A Resolution
 pdb|3CE9|C Chain C, Crystal Structure Of Glycerol Dehydrogenase (Np_348253.1)
           From Clostridium Acetobutylicum At 2.37 A Resolution
 pdb|3CE9|D Chain D, Crystal Structure Of Glycerol Dehydrogenase (Np_348253.1)
           From Clostridium Acetobutylicum At 2.37 A Resolution
          Length = 354

 Score = 31.6 bits (70), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 51/95 (53%), Gaps = 8/95 (8%)

Query: 35  TTTPRNGITYDRVNILIENERI-IPVCSVE--VLEINSKIKTACETQDQVGCKDLVAKI- 90
           T+T  +G +    ++LI  +R  +P  + +  V++I+  IK + E     G  DLV+ I 
Sbjct: 120 TSTSNDGFSSPVASLLINGKRTSVPAKTPDGIVVDIDV-IKGSPEKFIYSGIGDLVSNIT 178

Query: 91  --KEWAKESESNKSCIVDNAAVSVLAAAFESFSKT 123
              +W  E E++KS I+D+ AV +   +  SF +T
Sbjct: 179 ALYDWKFEEENHKS-IIDDFAVXISKKSVNSFVRT 212


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.130    0.367 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,728,130
Number of Sequences: 62578
Number of extensions: 303737
Number of successful extensions: 1025
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1025
Number of HSP's gapped (non-prelim): 1
length of query: 350
length of database: 14,973,337
effective HSP length: 100
effective length of query: 250
effective length of database: 8,715,537
effective search space: 2178884250
effective search space used: 2178884250
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)