Citrus Sinensis ID: 046830

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------52
MMMEEERLEEDEEEETTQEEAWAVISAYFEEKGLVRQQLDSFDEFNQNTMQEIVDESADIEIRPESQHNPGQQSDFAEIYLSKPMMTESDGETATLFLKAARLRNLTYSAPLYVDVTKRVIKKGHDGEEVPIMLRSSYCTLYQNSQKALTELGECPYDEGGYFIINGSEKVLIAQEKMSTNHVYVFKKRQPNKYAYVAEVCSMAESQNRPPSTIFVPMLSRTSAKGGSSGQYIHATLPYIRTEIPIIILFRALGFTADEDILEHICYDFQDTQMMELLRPSLEEAFFIQNQQYIGKRGATVGVTREKMIKYAKEILQKEMLPHVGTGDFCETKKAYYFGHIIHRLLLCALGRRAEDDRDHYGNKRLDLAGPLLGGLFRTLFRKLTGDVRSYVQKCVDNGKDVNLQFAIKAKTITGGLKYSLATGNWGQGNAAGTRAGVSQVLNCLTYASTFTYYLSWKLAKPRQLHNSQWGMMCPAETPEGQACGLVKNLALMVYITIGSAAYPILEFLEEWGTENFE
cccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHcHHHHHHHccccEEEccccccccccEEEEcEEEEcccCEEcccccccccccHHHHHccccccccEEEEEEEEEECccccccccccEEEccccccccccHHHHHHccccccccccEEEEcccEEEEEEEEcccccEEEEEECcccccccEEEEEEEEcccccccccEEEEEEEccccccccccccEEEEEcccccccccHHHHHHHcccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHcccccccccccccccccccEEEcccccHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHcEEEccccccHHHHHHHHHccccccc
***************TTQEEAWAVISAYFEEKGLVRQQLDSFDEFNQNTMQEIVDESADIEIRPESQHNPGQQSDFAEIYLSKPMMTESDGETATLFLKAARLRNLTYSAPLYVDVTKRVIKKGHDGEEVPIMLRSSYCTLYQNSQKALTELGECPYDEGGYFIINGSEKVLIAQEKMSTNHVYVFKKRQPNKYAYVAEVCSMA*********IFVP**********SSGQYIHATLPYIRTEIPIIILFRALGFTADEDILEHICYDFQDTQMMELLRPSLEEAFFIQNQQYIGKRGATVGVTREKMIKYAKEILQKEMLPHVGTGDFCETKKAYYFGHIIHRLLLCALGRRAEDDRDHYGNKRLDLAGPLLGGLFRTLFRKLTGDVRSYVQKCVDNGKDVNLQFAIKAKTITGGLKYSLATGNWGQGNAAGTRAGVSQVLNCLTYASTFTYYLSWKLAKPRQLHNSQWGMMCPAETPEGQACGLVKNLALMVYITIGSAAYPILEFLEEWGTENF*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxWAVISAYFEEKGLVRQQLDSFDEFNQNTMQEIVDESADIEIRPESQHNPGQQSDFAEIYLSKPMMTESDGETATLFLKAARLRNLTYSAPLYVDVTKRVIKKGHDGEEVPIMLRSSYCTLYQNSQKALTELGECPYDEGGYFIINGSEKVLIAQEKMSTNHVYVFKKRQPNKYAYVAEVCSMAESQNRPPSTIFVPMLSRTSAKGGSSGQYIHATLPYIRTEIPIIILFRALGFTADEDILEHICYDFQDTQMMELLRPSLEEAFFIQNQQYIGKRGATVGVTREKMIKYAKEILQKEMLPHVGTGDFCETKKAYYFGHIIHRLLLCALGRRAEDDRDHYGNKRLDLAGPLLGGLFRTLFRKLTGDVRSYVQKCVDNGKDVNLQFAIKAKTITGGLKYSLATGNWGQGNAAGTRAGVSQVLNCLTYASTFTYYLSWKLAKPRQLHNSQWGMMCPAETPEGQACGLVKNLALMVYITIGSAAYPILEFLEEWGTENFE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA-directed RNA polymerase II subunit RPB2 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Second largest component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB2 is part of the core element with the central large cleft, the clamp element that moves to open and close the cleft and the jaws that are thought to grab the incoming DNA template.probableP38420
DNA-directed RNA polymerase subunit B'' DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. The B (B''+B' and beta) subunits have been implicated in DNA promoter recognition and also in nucleotide binding.probableB0R8D6
DNA-directed RNA polymerase subunit B'' DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. The B (B''+B' and beta) subunits have been implicated in DNA promoter recognition and also in nucleotide binding.probableP41558

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.7.-Nucleotidyltransferases.probable
2.7.7.6DNA-directed RNA polymerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H0G, chain B
Confidence level:very confident
Coverage over the Query: 14-61,74-518
View the alignment between query and template
View the model in PyMOL