Citrus Sinensis ID: 046921

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MADEEQDKADRERVFKRFDLNGDGKISASELADCLNALSSVSDEEVKKMMAEIDTDGDGVISYDEFTAFAEANRGLIKNVAKIF
cccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHc
******D***RERVFKRFDLNGDGKISASELADCLNALSSVSDEEVKKMMAEIDTDGDGVISYDEFTAFAEANRGLIKNVAKIF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADEEQDKADRERVFKRFDLNGDGKISASELADCLNALSSVSDEEVKKMMAEIDTDGDGVISYDEFTAFAEANRGLIKNVAKIF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polcalcin Aln g 4 probableO81701
Polcalcin Che a 3 probableQ84V36
Probable calcium-binding protein CML28 Potential calcium sensor.probableQ9SRP7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OPO, chain A
Confidence level:very confident
Coverage over the Query: 4-84
View the alignment between query and template
View the model in PyMOL