Query         046926
Match_columns 226
No_of_seqs    284 out of 1834
Neff          8.6 
Searched_HMMs 46136
Date          Fri Mar 29 05:54:34 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/046926.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/046926hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd06899 lectin_legume_LecRK_Ar 100.0 1.2E-29 2.6E-34  209.2  12.4  105    6-110   112-235 (236)
  2 PF00139 Lectin_legB:  Legume l  99.9 1.2E-27 2.6E-32  197.4  10.4  101    7-108   114-236 (236)
  3 cd01951 lectin_L-type legume l  99.9 1.2E-22 2.6E-27  166.3  11.7  101    7-109   100-223 (223)
  4 KOG1187 Serine/threonine prote  98.6 2.4E-08 5.2E-13   87.4   4.1   39  186-224    61-99  (361)
  5 cd07308 lectin_leg-like legume  98.4 4.5E-06 9.7E-11   68.1  11.3   94    8-108    98-216 (218)
  6 cd06902 lectin_ERGIC-53_ERGL E  97.9  0.0001 2.2E-09   60.4  10.2   64   42-109   159-223 (225)
  7 PLN00113 leucine-rich repeat r  97.6  0.0001 2.2E-09   72.3   6.3   33  189-224   682-714 (968)
  8 KOG0196 Tyrosine kinase, EPH (  97.3 8.5E-05 1.8E-09   69.6   1.2   38  188-225   608-654 (996)
  9 KOG3653 Transforming growth fa  97.1 0.00066 1.4E-08   60.4   4.8   19  206-224   216-234 (534)
 10 PF08693 SKG6:  Transmembrane a  95.8   0.019 4.2E-07   33.5   3.7   27  134-163    13-39  (40)
 11 KOG1025 Epidermal growth facto  95.6   0.003 6.6E-08   60.0  -0.0   21  202-222   698-718 (1177)
 12 PF03388 Lectin_leg-like:  Legu  95.6   0.058 1.3E-06   44.3   7.5   58   42-105   163-223 (229)
 13 cd06903 lectin_EMP46_EMP47 EMP  95.6   0.099 2.1E-06   42.6   8.6   55   42-107   155-211 (215)
 14 cd06901 lectin_VIP36_VIPL VIP3  95.6    0.14 3.1E-06   42.6   9.6   62   42-109   161-222 (248)
 15 KOG3838 Mannose lectin ERGIC-5  94.7    0.36 7.9E-06   42.3   9.8   61   42-106   191-251 (497)
 16 PF04478 Mid2:  Mid2 like cell   94.7   0.065 1.4E-06   40.8   4.7   19  131-149    47-65  (154)
 17 PLN03224 probable serine/threo  94.7   0.015 3.3E-07   53.3   1.6   23  199-221   144-166 (507)
 18 PF14575 EphA2_TM:  Ephrin type  94.5   0.011 2.4E-07   39.8   0.1   18  188-205    55-72  (75)
 19 PLN03225 Serine/threonine-prot  94.0   0.054 1.2E-06   50.5   3.6   27  198-224   130-156 (566)
 20 PTZ00382 Variant-specific surf  93.8   0.086 1.9E-06   37.2   3.6   23  128-150    61-83  (96)
 21 KOG2052 Activin A type IB rece  93.8   0.089 1.9E-06   46.9   4.3   20  205-224   216-235 (513)
 22 KOG3839 Lectin VIP36, involved  93.5    0.29 6.3E-06   41.9   6.7   59   42-107   213-272 (351)
 23 PF06697 DUF1191:  Protein of u  91.0       1 2.3E-05   37.9   7.0    8   72-79    158-165 (278)
 24 KOG0193 Serine/threonine prote  90.7    0.12 2.6E-06   47.8   1.3   18  206-223   398-415 (678)
 25 PF15102 TMEM154:  TMEM154 prot  87.6    0.63 1.4E-05   35.3   3.1    7  190-196   125-131 (146)
 26 PTZ00284 protein kinase; Provi  87.0    0.18   4E-06   45.5  -0.1   31  193-223   122-152 (467)
 27 KOG1035 eIF-2alpha kinase GCN2  86.9    0.39 8.6E-06   47.9   2.1   23  198-220   477-499 (1351)
 28 KOG1024 Receptor-like protein   86.6       1 2.2E-05   40.0   4.2   25  200-224   284-308 (563)
 29 PF15065 NCU-G1:  Lysosomal tra  86.5     0.3 6.5E-06   42.6   0.9   30   85-114   281-310 (350)
 30 KOG0194 Protein tyrosine kinas  85.9    0.43 9.2E-06   43.4   1.6   18  206-223   163-180 (474)
 31 PF01102 Glycophorin_A:  Glycop  85.7    0.26 5.7E-06   36.3   0.2   17  131-147    62-78  (122)
 32 PF03302 VSP:  Giardia variant-  85.7    0.91   2E-05   40.5   3.6   28  127-154   361-388 (397)
 33 PTZ00036 glycogen synthase kin  83.0    0.58 1.3E-05   42.0   1.2   26  200-225    66-91  (440)
 34 PRK09605 bifunctional UGMP fam  82.4    0.67 1.5E-05   42.8   1.4   27  198-224   331-357 (535)
 35 KOG1026 Nerve growth factor re  81.5     2.2 4.7E-05   41.0   4.4   19  206-224   492-510 (774)
 36 cd05622 STKc_ROCK1 Catalytic d  81.5    0.63 1.4E-05   40.7   0.9   34  192-225    35-68  (371)
 37 PF12877 DUF3827:  Domain of un  80.8     1.6 3.4E-05   40.8   3.1   23  128-150   265-287 (684)
 38 cd05104 PTKc_Kit Catalytic dom  80.6    0.79 1.7E-05   40.1   1.2   20  202-221    37-56  (375)
 39 KOG0192 Tyrosine kinase specif  80.0    0.99 2.1E-05   39.7   1.5   19  206-224    47-65  (362)
 40 cd05621 STKc_ROCK2 Catalytic d  79.6    0.78 1.7E-05   40.1   0.8   26  199-224    42-67  (370)
 41 KOG0986 G protein-coupled rece  79.3     1.1 2.3E-05   40.6   1.5   26  200-225   185-210 (591)
 42 cd05596 STKc_ROCK Catalytic do  78.9    0.59 1.3E-05   40.8  -0.2   26  199-224    42-67  (370)
 43 PLN00034 mitogen-activated pro  78.4     1.3 2.8E-05   38.2   1.8   20  205-224    79-98  (353)
 44 cd05105 PTKc_PDGFR_alpha Catal  77.6     1.6 3.4E-05   38.8   2.1   20  202-221    39-58  (400)
 45 PF02480 Herpes_gE:  Alphaherpe  77.6    0.73 1.6E-05   41.6   0.0   14  134-147   353-366 (439)
 46 PHA03209 serine/threonine kina  77.2     1.6 3.5E-05   37.8   2.1   27  198-224    64-90  (357)
 47 cd05106 PTKc_CSF-1R Catalytic   77.1     1.5 3.3E-05   38.3   1.9   20  202-221    40-59  (374)
 48 KOG1095 Protein tyrosine kinas  76.8     1.4 3.1E-05   43.6   1.7   20  205-224   697-716 (1025)
 49 cd05107 PTKc_PDGFR_beta Cataly  76.8     1.5 3.2E-05   39.0   1.7   21  202-222    39-59  (401)
 50 KOG0663 Protein kinase PITSLRE  76.7    0.77 1.7E-05   39.9  -0.1   21  201-221    77-97  (419)
 51 PHA03211 serine/threonine kina  76.5     1.8 3.9E-05   39.3   2.2   24  201-224   170-193 (461)
 52 PHA03210 serine/threonine kina  75.6     1.7 3.7E-05   39.8   1.8   23  200-222   148-170 (501)
 53 KOG1094 Discoidin domain recep  72.9      17 0.00037   34.3   7.4   25   11-40    263-287 (807)
 54 PF15345 TMEM51:  Transmembrane  70.2      11 0.00023   30.9   5.0    8  190-197   125-132 (233)
 55 KOG4258 Insulin/growth factor   70.0     3.5 7.7E-05   39.9   2.5   22  202-223   996-1017(1025)
 56 PF06365 CD34_antigen:  CD34/Po  69.9     6.4 0.00014   31.7   3.6   10  133-142   100-109 (202)
 57 PF12273 RCR:  Chitin synthesis  69.6       2 4.3E-05   32.0   0.6    8  159-166    20-27  (130)
 58 PF08374 Protocadherin:  Protoc  68.9     4.9 0.00011   32.5   2.7   21  131-151    36-56  (221)
 59 KOG1167 Serine/threonine prote  68.3     1.4 3.1E-05   39.0  -0.4   25  199-223    35-59  (418)
 60 cd05055 PTKc_PDGFR Catalytic d  68.1     2.4 5.3E-05   35.6   1.0   21  201-221    36-56  (302)
 61 PF11770 GAPT:  GRB2-binding ad  67.9     1.8 3.8E-05   32.9   0.1   25  137-161    11-35  (158)
 62 KOG4257 Focal adhesion tyrosin  66.2     3.1 6.7E-05   39.3   1.3   19  205-223   394-412 (974)
 63 PF13908 Shisa:  Wnt and FGF in  66.0     3.9 8.6E-05   32.0   1.7    6   88-93     18-23  (179)
 64 PF14991 MLANA:  Protein melan-  65.0       2 4.4E-05   31.0  -0.1    6  158-163    46-51  (118)
 65 KOG0605 NDR and related serine  64.5     4.6 9.9E-05   37.1   2.0   26  200-225   141-166 (550)
 66 PF05454 DAG1:  Dystroglycan (D  64.2     2.2 4.8E-05   36.3   0.0    9   24-32     34-42  (290)
 67 PF12191 stn_TNFRSF12A:  Tumour  63.6       3 6.6E-05   30.7   0.6   17  130-146    75-91  (129)
 68 KOG0600 Cdc2-related protein k  61.7     2.9 6.3E-05   38.2   0.3   21  202-222   119-139 (560)
 69 PHA03212 serine/threonine kina  61.2     5.4 0.00012   35.2   1.9   23  201-223    93-115 (391)
 70 PF10577 UPF0560:  Uncharacteri  61.0     3.6 7.9E-05   39.5   0.8    9  102-110   235-243 (807)
 71 PF01299 Lamp:  Lysosome-associ  60.5     4.3 9.3E-05   34.8   1.1   15  134-148   271-285 (306)
 72 PF10873 DUF2668:  Protein of u  59.0      15 0.00032   27.9   3.5   26  130-155    58-83  (155)
 73 KOG1151 Tousled-like protein k  58.6     1.5 3.3E-05   39.6  -2.0   16  205-220   468-483 (775)
 74 PF14610 DUF4448:  Protein of u  57.6      13 0.00027   29.5   3.3   15  135-149   159-173 (189)
 75 KOG0694 Serine/threonine prote  56.0     6.7 0.00015   37.1   1.6   26  200-225   368-393 (694)
 76 PHA03265 envelope glycoprotein  55.5      11 0.00025   32.7   2.8    8   27-34    167-174 (402)
 77 PF12768 Rax2:  Cortical protei  54.0      16 0.00035   31.0   3.5   16  128-143   222-237 (281)
 78 KOG1006 Mitogen-activated prot  53.8     5.4 0.00012   33.8   0.6   31  188-225    59-89  (361)
 79 KOG1166 Mitotic checkpoint ser  52.4     6.9 0.00015   38.9   1.1   22  202-223   700-721 (974)
 80 KOG4236 Serine/threonine prote  50.8     7.9 0.00017   36.0   1.2   23  202-225   567-589 (888)
 81 PF07213 DAP10:  DAP10 membrane  50.1      13 0.00028   25.1   1.8   21  129-149    30-50  (79)
 82 PHA03207 serine/threonine kina  49.3      10 0.00023   33.2   1.7   21  202-222    94-114 (392)
 83 KOG0032 Ca2+/calmodulin-depend  47.6      14  0.0003   32.8   2.2   20  206-225    41-60  (382)
 84 KOG0581 Mitogen-activated prot  47.3      19  0.0004   31.7   2.8   28  190-224    76-103 (364)
 85 PF01102 Glycophorin_A:  Glycop  46.7     5.4 0.00012   29.4  -0.4   12  133-144    68-79  (122)
 86 TIGR01982 UbiB 2-polyprenylphe  45.0      14  0.0003   33.4   1.8   22  202-224   120-141 (437)
 87 KOG0197 Tyrosine kinases [Sign  44.9      12 0.00026   34.0   1.4   19  206-224   212-230 (468)
 88 PF15176 LRR19-TM:  Leucine-ric  43.6      18 0.00038   25.7   1.8   21  129-149    14-34  (102)
 89 cd06900 lectin_VcfQ VcfQ bacte  43.4 1.3E+02  0.0029   25.0   7.1   27   79-105   225-251 (255)
 90 TIGR01478 STEVOR variant surfa  39.2      20 0.00043   30.4   1.7   15  150-164   275-289 (295)
 91 PTZ00370 STEVOR; Provisional    37.7      21 0.00046   30.2   1.7   15  150-164   271-285 (296)
 92 PTZ00267 NIMA-related protein   36.8      17 0.00037   33.0   1.1   19  204-222    71-89  (478)
 93 PF04689 S1FA:  DNA binding pro  35.8      65  0.0014   20.8   3.3   22  128-149     8-29  (69)
 94 PF14014 DUF4230:  Protein of u  35.7      70  0.0015   24.1   4.2   41   28-78     48-88  (157)
 95 PTZ00046 rifin; Provisional     35.3      12 0.00026   32.7  -0.1   22  145-166   327-348 (358)
 96 TIGR01477 RIFIN variant surfac  34.1      13 0.00028   32.5  -0.1   21  146-166   323-343 (353)
 97 PF15102 TMEM154:  TMEM154 prot  33.8      66  0.0014   24.5   3.6    9  135-143    58-66  (146)
 98 KOG0584 Serine/threonine prote  33.2      20 0.00043   33.7   1.0   19  207-225    47-65  (632)
 99 PRK04750 ubiB putative ubiquin  32.7      38 0.00083   31.6   2.7   24  201-225   121-144 (537)
100 KOG0199 ACK and related non-re  32.7      19 0.00041   34.8   0.7   17  207-223   117-133 (1039)
101 KOG0200 Fibroblast/platelet-de  31.8      27 0.00058   33.0   1.6   17  207-223   303-319 (609)
102 TIGR01624 LRP1_Cterm LRP1 C-te  31.6      36 0.00079   20.7   1.6   12  214-225    38-49  (50)
103 PF02480 Herpes_gE:  Alphaherpe  30.8      16 0.00036   33.0   0.0    8  134-141   357-364 (439)
104 KOG4279 Serine/threonine prote  30.7      23  0.0005   34.3   0.9   18  203-220   578-595 (1226)
105 PF03229 Alpha_GJ:  Alphavirus   29.2      43 0.00094   24.4   1.9   16  134-149    84-99  (126)
106 KOG0607 MAP kinase-interacting  29.1      45 0.00098   29.3   2.3   24  191-219    74-97  (463)
107 PLN03150 hypothetical protein;  28.6      88  0.0019   29.7   4.4   14  132-145   543-556 (623)
108 COG4282 SMI1 Protein involved   28.6      79  0.0017   24.7   3.3   29   24-52    126-157 (191)
109 PHA03291 envelope glycoprotein  27.9      35 0.00077   29.8   1.5   18   42-59    147-164 (401)
110 PF05808 Podoplanin:  Podoplani  27.8      20 0.00043   27.7   0.0   24  127-150   123-146 (162)
111 KOG3482 Small nuclear ribonucl  27.5      40 0.00088   22.3   1.4   19  205-223    19-37  (79)
112 PF14914 LRRC37AB_C:  LRRC37A/B  27.4      35 0.00076   26.0   1.2   14  133-146   120-133 (154)
113 PF10049 DUF2283:  Protein of u  26.6      82  0.0018   19.0   2.6   15   44-58      2-16  (50)
114 PF04971 Lysis_S:  Lysis protei  26.6      25 0.00053   23.1   0.2    9  134-142    34-42  (68)
115 PF07472 PA-IIL:  Fucose-bindin  25.7 2.6E+02  0.0056   20.1   5.4   54   46-106    49-106 (107)
116 KOG4278 Protein tyrosine kinas  23.0      46 0.00099   31.9   1.4   21  202-222   269-289 (1157)
117 KOG1989 ARK protein kinase fam  22.9      46   0.001   32.2   1.4   20  205-224    42-61  (738)
118 KOG4645 MAPKKK (MAP kinase kin  22.5      44 0.00095   34.5   1.2   28  198-225  1233-1260(1509)
119 PTZ00208 65 kDa invariant surf  21.4      24 0.00053   31.3  -0.7    7  211-217   427-433 (436)
120 COG4540 gpV Phage P2 baseplate  21.1      62  0.0013   25.3   1.6   18   42-59     95-112 (184)
121 PF11225 DUF3024:  Protein of u  20.4      86  0.0019   19.6   1.9   21   42-62      6-26  (57)

No 1  
>cd06899 lectin_legume_LecRK_Arcelin_ConA legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor. This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor.  Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids.  Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family.  Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins.  PHA agglutinates most mammalian red blood cell types by bindin
Probab=99.96  E-value=1.2e-29  Score=209.15  Aligned_cols=105  Identities=45%  Similarity=0.595  Sum_probs=97.3

Q ss_pred             CCCCCeEEEEEecccCC--CCCCCCeeEEEcCCCCccc-----------------eEEEEEcCCCcEEEEEEEeCCCCCc
Q 046926            6 NSSIPFVAVESDVYVNS--WDPTFSHVGVDINSVQSKK-----------------NAWISYNSSTHNLSVAFTGFRNNSV   66 (226)
Q Consensus         6 ~~~~~~~avefdt~~n~--~d~~~~hvgi~~n~~~s~~-----------------~~~i~y~~~~~~l~v~~~~~~~~~~   66 (226)
                      .+.+++|||||||++|.  +||++||||||+|++.|..                 +|||+||+.+++|+|+|.+....+|
T Consensus       112 ~~~~~~vAVEFDT~~n~~~~D~~~nHigIdvn~~~S~~~~~~~~~~~~l~~g~~~~v~I~Y~~~~~~L~V~l~~~~~~~~  191 (236)
T cd06899         112 NSSNHIVAVEFDTFQNPEFGDPDDNHVGIDVNSLVSVKAGYWDDDGGKLKSGKPMQAWIDYDSSSKRLSVTLAYSGVAKP  191 (236)
T ss_pred             CcccceEEEEeecccCcccCCCCCCeEEEEcCCcccceeeccccccccccCCCeEEEEEEEcCCCCEEEEEEEeCCCCCC
Confidence            46789999999999997  3999999999999987643                 7999999999999999998877789


Q ss_pred             ccceeEEEeccccCCCcceEeeEeeecccccceeecccccccCC
Q 046926           67 VMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNSS  110 (226)
Q Consensus        67 ~~~~l~~~~~Ls~~l~~~v~vGFsastg~~~~~~~il~W~f~s~  110 (226)
                      ..|+|+..+||+.+||++|||||+|+||...+.|+|++|+|+++
T Consensus       192 ~~~~ls~~vdL~~~l~~~~~vGFSasTG~~~~~h~i~sWsF~s~  235 (236)
T cd06899         192 KKPLLSYPVDLSKVLPEEVYVGFSASTGLLTELHYILSWSFSSN  235 (236)
T ss_pred             cCCEEEEeccHHHhCCCceEEEEEeEcCCCcceEEEEEEEEEcC
Confidence            99999999999999999999999999999999999999999875


No 2  
>PF00139 Lectin_legB:  Legume lectin domain;  InterPro: IPR001220 Legume lectins are one of the largest lectin families with more than 70 lectins reported. Leguminous plant lectins resemble each other in their physicochemical properties although they differ in their carbohydrate specificities. They consist of two or four subunits with relative molecular mass of 30 kDa and each subunit has one carbohydrate-binding site. The interaction with sugars requires tightly bound calcium and manganese ions. The structural similarities of these lectins are reported by the primary structural analyses and X-ray crystallographic studies. X-ray studies have shown that the folding of the polypeptide chains in the region of the carbohydrate-binding sites is also similar, despite differences in the primary sequences. The carbohydrate-binding sites of these lectins consist of two conserved amino acids on beta pleated sheets. One of these loops contains transition metals, calcium and manganese, which keep the amino acid residues of the sugar-binding site at the required positions. Amino acid sequences of this loop play an important role in the carbohydrate-binding specificities of these lectins. These lectins bind either glucose/mannose or galactose. The exact function of legume lectins is not known but they may be involved in the attachment of nitrogen-fixing bacteria to legumes and in the protection against pathogens. Some legume lectins are proteolytically processed to produce two chains, beta (which corresponds to the N-terminal) and alpha (C-terminal) (IPR000985 from INTERPRO). The lectin concanavalin A (conA) from jack bean is exceptional in that the two chains are transposed and ligated (by formation of a new peptide bond). The N terminus of mature conA thus corresponds to that of the alpha chain and the C terminus to the beta chain.; GO: 0005488 binding; PDB: 1VLN_B 2GDF_C 2JE9_C 2JEC_C 1DGL_B 2P37_B 2CWM_A 2P34_D 2OW4_A 3IPV_B ....
Probab=99.95  E-value=1.2e-27  Score=197.39  Aligned_cols=101  Identities=42%  Similarity=0.598  Sum_probs=91.8

Q ss_pred             CCCCeEEEEEecccCC--CCCCCCeeEEEcCCCCccc--------------------eEEEEEcCCCcEEEEEEEeCCCC
Q 046926            7 SSIPFVAVESDVYVNS--WDPTFSHVGVDINSVQSKK--------------------NAWISYNSSTHNLSVAFTGFRNN   64 (226)
Q Consensus         7 ~~~~~~avefdt~~n~--~d~~~~hvgi~~n~~~s~~--------------------~~~i~y~~~~~~l~v~~~~~~~~   64 (226)
                      +.++.|||||||++|.  .||+.+|||||+|++.+..                    +|||+||+.+++|+|++.... .
T Consensus       114 ~~~~~vAVEFDT~~N~~~~d~~~nHIgI~~n~~~s~~~~~~~~~~~~~~~l~~g~~~~v~I~Yd~~~~~L~V~l~~~~-~  192 (236)
T PF00139_consen  114 GINNSVAVEFDTYKNPEYNDPDDNHIGIDVNSVVSNKTASAGYYSSPSFSLSDGKWHTVWIDYDASTKRLSVYLDDNS-S  192 (236)
T ss_dssp             GGGCEEEEEEETSTCGGGTTTSSSEEEEEESSSSESEEEE----EEEEHHHGTTSEEEEEEEEETTTTEEEEEEEETT-T
T ss_pred             ccCcEEEEEEeeeecccccccCCCEEEEECCCCcccccccccccccccccccCCcEEEEEEEEcCCccEEEEEEeccc-C
Confidence            3678999999999986  7999999999999997632                    899999999999999999885 6


Q ss_pred             CcccceeEEEeccccCCCcceEeeEeeecccccceeeccccccc
Q 046926           65 SVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFN  108 (226)
Q Consensus        65 ~~~~~~l~~~~~Ls~~l~~~v~vGFsastg~~~~~~~il~W~f~  108 (226)
                      +|..|+|+..+||+.+++++|||||+|+||...+.|.|++|+|+
T Consensus       193 ~~~~~~l~~~vdL~~~l~~~v~vGFsasTG~~~~~h~I~sW~F~  236 (236)
T PF00139_consen  193 KPSSPVLSVNVDLSAVLPEQVYVGFSASTGGSYQTHDILSWSFS  236 (236)
T ss_dssp             TSEEEEEEEE--HHHHSCSEEEEEEEEEESSSSEEEEEEEEEEE
T ss_pred             CCcceeEEEEEchHHhcCCCcEEEEEeecCCCcceEEEEEEEeC
Confidence            89999999999999999999999999999999999999999985


No 3  
>cd01951 lectin_L-type legume lectins. The L-type (legume-type) lectins are a highly diverse family of carbohydrate binding proteins that generally display no enzymatic activity toward the sugars they bind.  This family includes arcelin, concanavalinA, the lectin-like receptor kinases, the ERGIC-53/VIP36/EMP46 type1 transmembrane proteins, and an alpha-amylase inhibitor.  L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face".  This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded sheet and homotetramers occur by a back-to-back association of these homodimers.  Though L-type lectins exhibit both sequence and structural similarity to one another, their carbohydrate binding specificities differ widely.
Probab=99.89  E-value=1.2e-22  Score=166.30  Aligned_cols=101  Identities=30%  Similarity=0.418  Sum_probs=90.7

Q ss_pred             CCCCeEEEEEecccCC--CCCCCCeeEEEcCCCCcc-------c--------------eEEEEEcCCCcEEEEEEEeCCC
Q 046926            7 SSIPFVAVESDVYVNS--WDPTFSHVGVDINSVQSK-------K--------------NAWISYNSSTHNLSVAFTGFRN   63 (226)
Q Consensus         7 ~~~~~~avefdt~~n~--~d~~~~hvgi~~n~~~s~-------~--------------~~~i~y~~~~~~l~v~~~~~~~   63 (226)
                      ..++.+||||||++|.  +||+.+|||||+|+..+.       .              +|||+||+.+++|+|+|.+...
T Consensus       100 ~~~~~~aVefDT~~N~~~~dp~~~higi~~n~~~~~~~~~~~~~~~~~~~~~~~g~~~~v~I~Y~~~~~~L~v~l~~~~~  179 (223)
T cd01951         100 GIGNSVAVEFDTYKNDDNNDPNGNHISIDVNGNGNNTALATSLGSASLPNGTGLGNEHTVRITYDPTTNTLTVYLDNGST  179 (223)
T ss_pred             ccCCeEEEEEeccccCCCCCCCCCEEEEEcCCCCCCcccccccceeeCCCccCCCCEEEEEEEEeCCCCEEEEEECCCCc
Confidence            4578999999999997  699999999999998632       1              7999999999999999987653


Q ss_pred             CCcccceeEEEeccccCCCcceEeeEeeecccccceeecccccccC
Q 046926           64 NSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNS  109 (226)
Q Consensus        64 ~~~~~~~l~~~~~Ls~~l~~~v~vGFsastg~~~~~~~il~W~f~s  109 (226)
                        |..|+++.++||+..++++||+||+|+||...+.|.|+.|+|+.
T Consensus       180 --~~~~~l~~~~~l~~~~~~~~yvGFTAsTG~~~~~h~V~~wsf~~  223 (223)
T cd01951         180 --LTSLDITIPVDLIQLGPTKAYFGFTASTGGLTNLHDILNWSFTS  223 (223)
T ss_pred             --cccccEEEeeeecccCCCcEEEEEEcccCCCcceeEEEEEEecC
Confidence              67799999999999999999999999999999999999999963


No 4  
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=98.64  E-value=2.4e-08  Score=87.43  Aligned_cols=39  Identities=46%  Similarity=0.881  Sum_probs=36.7

Q ss_pred             CCceechHHHHHHHhCCCcCCccccCCCcceEEEEeCCC
Q 046926          186 GPKRFPYKELALATNDFNDDQKLGQGGFGGVYKGFLRET  224 (226)
Q Consensus       186 ~~~~f~~~el~~AT~~F~~~n~lG~GgfG~VYKG~L~~~  224 (226)
                      ..+.|+|+||.+||++|+++|+||+||||.||||.|++.
T Consensus        61 ~~~~fs~~el~~AT~~Fs~~~~ig~Ggfg~VYkG~l~~~   99 (361)
T KOG1187|consen   61 PLRSFSYDELRKATNNFSESNLIGEGGFGTVYKGVLSDG   99 (361)
T ss_pred             CcceeeHHHHHHHHhCCchhcceecCCCeEEEEEEECCC
Confidence            567899999999999999999999999999999999874


No 5  
>cd07308 lectin_leg-like legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47. The legume-like (leg-like) lectins are eukaryotic intracellular sugar transport proteins with a carbohydrate recognition domain similar to that of the legume lectins.  This domain binds high-mannose-type oligosaccharides for transport from the endoplasmic reticulum to the Golgi complex.  These leg-like lectins include ERGIC-53, ERGL, VIP36, VIPL, EMP46, EMP47, and the UIP5 (ULP1-interacting protein 5) precursor protein.  Leg-like lectins have different intracellular distributions and dynamics in the endoplasmic reticulum-Golgi system of the secretory pathway and interact with N-glycans of glycoproteins in a calcium-dependent manner, suggesting a role in glycoprotein sorting and trafficking.  L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "ba
Probab=98.40  E-value=4.5e-06  Score=68.08  Aligned_cols=94  Identities=27%  Similarity=0.169  Sum_probs=61.2

Q ss_pred             CCCeEEEEEecccCCCCCCCCeeEEEcCCCC-c------------------------cceEEEEEcCCCcEEEEEEEeCC
Q 046926            8 SIPFVAVESDVYVNSWDPTFSHVGVDINSVQ-S------------------------KKNAWISYNSSTHNLSVAFTGFR   62 (226)
Q Consensus         8 ~~~~~avefdt~~n~~d~~~~hvgi~~n~~~-s------------------------~~~~~i~y~~~~~~l~v~~~~~~   62 (226)
                      ..+-+||||||+.|. +-...+|-+-+|--. +                        ..+++|.|+  .+.|.|.+.+..
T Consensus        98 ~~~Glai~fdt~~n~-~~~~p~i~~~~Ndg~~~~~~~~d~~~~~~~~c~~~~~~~~~~~~~~I~y~--~~~l~v~i~~~~  174 (218)
T cd07308          98 KFKGLAIFFDTYDND-GKGFPSISVFLNDGTKSYDYETDGEKLELASCSLKFRNSNAPTTLRISYL--NNTLKVDITYSE  174 (218)
T ss_pred             CCCEEEEEEEcCCCC-CCCCCeEEEEEeCCCceecccCCCccccccceeEecccCCCCeEEEEEEE--CCEEEEEEeCCC
Confidence            356799999999985 222223333222111 0                        007999999  578999887542


Q ss_pred             CCCcccceeEEEeccccCCCcceEeeEeeecccccceeeccccccc
Q 046926           63 NNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFN  108 (226)
Q Consensus        63 ~~~~~~~~l~~~~~Ls~~l~~~v~vGFsastg~~~~~~~il~W~f~  108 (226)
                         +....+...++.- .+|+..|+||+|.||...+.|.|++|.+.
T Consensus       175 ---~~~~~~c~~~~~~-~l~~~~y~G~sA~tg~~~d~~dIls~~~~  216 (218)
T cd07308         175 ---GNNWKECFTVEDV-ILPSQGYFGFSAQTGDLSDNHDILSVHTY  216 (218)
T ss_pred             ---CCCccEEEEcCCc-ccCCCCEEEEEeccCCCcCcEEEEEEEee
Confidence               1122233333322 56788999999999999999999998763


No 6  
>cd06902 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain. ERGIC-53 and ERGL, N-terminal carbohydrate recognition domain. ERGIC-53 and ERGL are eukaryotic mannose-binding type 1 transmembrane proteins of the early secretory pathway that transport newly synthesized glycoproteins from the endoplasmic reticulum (ER) to the ER-Golgi intermediate compartment (ERGIC).  ERGIC-53 and ERGL have an N-terminal lectin-like carbohydrate recognition domain (represented by this alignment model) as well as a C-terminal transmembrane domain.  ERGIC-53 functions as a 'cargo receptor' to facilitate the export of glycoproteins with different characteristics from the ER, while the ERGIC-53-like protein (ERGL) which may act as a regulator of ERGIC-53.  In mammals, ERGIC-53 forms a complex with MCFD2 (multi-coagulation factor deficiency 2) which then recruits blood coagulation factors V and VIII.  Mutations in either MCFD2 or ERGIC-53 cause a mild form of inherite
Probab=97.94  E-value=0.0001  Score=60.44  Aligned_cols=64  Identities=25%  Similarity=0.110  Sum_probs=42.9

Q ss_pred             eEEEEEcCCCcEEEEEEEeCCCCCcccceeEEEecccc-CCCcceEeeEeeecccccceeecccccccC
Q 046926           42 NAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRL-HLPEFVTFGFSMATGVDFAIFSIYSWEFNS  109 (226)
Q Consensus        42 ~~~i~y~~~~~~l~v~~~~~~~~~~~~~~l~~~~~Ls~-~l~~~v~vGFsastg~~~~~~~il~W~f~s  109 (226)
                      ++.|.|...  .|.|.+.....+....-.+.  +++.. .||+..|+||+|.||...+.|.|++|.+.+
T Consensus       159 ~~rI~Y~~~--~l~V~~d~~~~~~~~~~~~C--f~~~~v~LP~~~yfGiSA~Tg~l~d~hDIls~~~~s  223 (225)
T cd06902         159 RAKITYYQN--VLTVSINNGFTPNKDDYELC--TRVENMVLPPNGYFGVSAATGGLADDHDVLSFLTFS  223 (225)
T ss_pred             EEEEEEECC--eEEEEEeCCcCCCCCcccEE--EecCCeeCCCCCEEEEEecCCCCCCcEeEEEEEEec
Confidence            789999884  58888864332121111111  12222 467789999999999999999999988753


No 7  
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional
Probab=97.61  E-value=0.0001  Score=72.27  Aligned_cols=33  Identities=15%  Similarity=0.359  Sum_probs=25.7

Q ss_pred             eechHHHHHHHhCCCcCCccccCCCcceEEEEeCCC
Q 046926          189 RFPYKELALATNDFNDDQKLGQGGFGGVYKGFLRET  224 (226)
Q Consensus       189 ~f~~~el~~AT~~F~~~n~lG~GgfG~VYKG~L~~~  224 (226)
                      .++++++..   .+.+.++||+|+||.||||.....
T Consensus       682 ~~~~~~~~~---~~~~~~~ig~G~~g~Vy~~~~~~~  714 (968)
T PLN00113        682 SITINDILS---SLKEENVISRGKKGASYKGKSIKN  714 (968)
T ss_pred             hhhHHHHHh---hCCcccEEccCCCeeEEEEEECCC
Confidence            456666554   478889999999999999987543


No 8  
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms]
Probab=97.30  E-value=8.5e-05  Score=69.60  Aligned_cols=38  Identities=26%  Similarity=0.534  Sum_probs=31.9

Q ss_pred             ceechHHHHHHHhCCCc---------CCccccCCCcceEEEEeCCCC
Q 046926          188 KRFPYKELALATNDFND---------DQKLGQGGFGGVYKGFLRETN  225 (226)
Q Consensus       188 ~~f~~~el~~AT~~F~~---------~n~lG~GgfG~VYKG~L~~~~  225 (226)
                      ..++|+|--+|...|..         +.+||.|.||.||+|.|.-.|
T Consensus       608 DP~TYEDPnqAvreFakEId~s~i~Ie~VIGaGEFGEVc~GrLk~pg  654 (996)
T KOG0196|consen  608 DPHTYEDPNQAVREFAKEIDPSCVKIEKVIGAGEFGEVCSGRLKLPG  654 (996)
T ss_pred             CCccccCccHHHHHhhhhcChhheEEEEEEecccccceecccccCCC
Confidence            45789998888888776         689999999999999997544


No 9  
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms]
Probab=97.13  E-value=0.00066  Score=60.43  Aligned_cols=19  Identities=37%  Similarity=0.714  Sum_probs=16.9

Q ss_pred             CccccCCCcceEEEEeCCC
Q 046926          206 QKLGQGGFGGVYKGFLRET  224 (226)
Q Consensus       206 n~lG~GgfG~VYKG~L~~~  224 (226)
                      .+||+|+||.||||.|.++
T Consensus       216 eli~~Grfg~V~KaqL~~~  234 (534)
T KOG3653|consen  216 ELIGRGRFGCVWKAQLDNR  234 (534)
T ss_pred             HHhhcCccceeehhhccCc
Confidence            3899999999999999764


No 10 
>PF08693 SKG6:  Transmembrane alpha-helix domain;  InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ]. This entry represents the highly conserved transmembrane alpha-helical domain found in these proteins [, ]. The full-length AXL2 protein has a negative regulatory function in cytokinesis [].
Probab=95.77  E-value=0.019  Score=33.49  Aligned_cols=27  Identities=19%  Similarity=0.171  Sum_probs=11.4

Q ss_pred             cEEeeehhhHHHHHHHHHHHHhhhheeecc
Q 046926          134 PVVGLSLGGGFLVGGVVLIIRLAGIGRKRK  163 (226)
Q Consensus       134 ~ii~i~v~~~~~~~~~~~~~~~~~~~~r~~  163 (226)
                      +.+++++.+++++++++++++   +|+||+
T Consensus        13 Ia~~VvVPV~vI~~vl~~~l~---~~~rR~   39 (40)
T PF08693_consen   13 IAVGVVVPVGVIIIVLGAFLF---FWYRRK   39 (40)
T ss_pred             EEEEEEechHHHHHHHHHHhh---eEEecc
Confidence            344444444444433333333   455543


No 11 
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms]
Probab=95.63  E-value=0.003  Score=59.98  Aligned_cols=21  Identities=48%  Similarity=0.906  Sum_probs=17.9

Q ss_pred             CCcCCccccCCCcceEEEEeC
Q 046926          202 FNDDQKLGQGGFGGVYKGFLR  222 (226)
Q Consensus       202 F~~~n~lG~GgfG~VYKG~L~  222 (226)
                      +.++.+||.|+||+||||..-
T Consensus       698 lkk~kvLGsgAfGtV~kGiw~  718 (1177)
T KOG1025|consen  698 LKKDKVLGSGAFGTVYKGIWI  718 (1177)
T ss_pred             hhhhceeccccceeEEeeeEe
Confidence            566779999999999999763


No 12 
>PF03388 Lectin_leg-like:  Legume-like lectin family;  InterPro: IPR005052  Lectins are structurally diverse proteins that bind to specific carbohydrates. This family includes the VIP36 and ERGIC-53 lectins. These two proteins were the first members of the family of animal lectins similar to the leguminous plant lectins []. The alignment for this family is towards the N terminus, where the similarity of VIP36 and ERGIC-53 is greatest. Although they have been identified as a family of animal lectins, this alignment also includes yeast sequences[].  ERGIC-53 is a 53kDa protein, localised to the intermediate region between the endoplasmic reticulum and the Golgi apparatus (ER-Golgi-Intermediate Compartment, ERGIC). It was identified as a calcium-dependent, mannose-specific lectin []. Its dysfunction has been associated with combined factors V and VIII deficiency, suggesting an important and substrate-specific role for ERGIC-53 in the glycoprotein-secreting pathway [,]. The L-type lectin-like domain has an overall globular shape composed of a beta-sandwich of two major twisted antiparallel beta-sheets. The beta-sandwich comprises a major concave beta-sheet and a minor convex beta-sheet, in a variation of the jelly roll fold [, , , ]. ; GO: 0016020 membrane; PDB: 3A4U_A 3LCP_B 2A6Z_A 2A71_C 2A70_B 2A6Y_A 2A6X_A 2A6W_B 2A6V_B 2E6V_B ....
Probab=95.61  E-value=0.058  Score=44.32  Aligned_cols=58  Identities=31%  Similarity=0.288  Sum_probs=38.5

Q ss_pred             eEEEEEcCCCcEEEEEEEeC--CCCCcccceeEEE-eccccCCCcceEeeEeeecccccceeecccc
Q 046926           42 NAWISYNSSTHNLSVAFTGF--RNNSVVMQGLDYQ-VDLRLHLPEFVTFGFSMATGVDFAIFSIYSW  105 (226)
Q Consensus        42 ~~~i~y~~~~~~l~v~~~~~--~~~~~~~~~l~~~-~~Ls~~l~~~v~vGFsastg~~~~~~~il~W  105 (226)
                      ++.|.|...  .|.|.+...  .....-..++... +    .||+.-|+||+|+||...+.|.|++.
T Consensus       163 ~~ri~Y~~~--~l~v~id~~~~~~~~~~~~Cf~~~~v----~LP~~~yfGvSA~Tg~~~d~hdi~s~  223 (229)
T PF03388_consen  163 RIRISYSKN--TLTVSIDSNYLKNQDDWELCFTTDGV----DLPEGYYFGVSAATGELSDNHDILSV  223 (229)
T ss_dssp             EEEEEEETT--EEEEEEETSCCSECCTTEEEEEESTE----EGGSSBEEEEEEEESSSGGEEEEEEE
T ss_pred             EEEEEEECC--eEEEEEecccccCCcCCcEEEEcCCe----ecCCCCEEEEEecCCCCCCcEEEEEE
Confidence            688888875  466666522  1112223444432 3    35777899999999999999999764


No 13 
>cd06903 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmembrane proteins, N-terminal lectin domain. EMP46 and EMP47, N-terminal carbohydrate recognition domain. EMP46 and EMP47 are fungal type-I transmembrane proteins that cycle between the endoplasmic reticulum and the golgi apparatus and are thought to function as cargo receptors that transport newly synthesized glycoproteins.  EMP47 is a receptor for EMP46 responsible for the selective transport of EMP46 by forming hetero-oligomerization between the two proteins. EMP46 and EMP47 have an N-terminal lectin-like carbohydrate recognition domain (represented by this alignment model) as well as a C-terminal transmembrane domain. EMP46 and EMP47 are 45% sequence-identical to one another and have sequence homology to a class of intracellular lectins defined by ERGIC-53 and VIP36.  L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat s
Probab=95.57  E-value=0.099  Score=42.56  Aligned_cols=55  Identities=20%  Similarity=0.277  Sum_probs=38.0

Q ss_pred             eEEEEEcCCCcEEEEEEEeCCCCCcccceeEE-EeccccCCC-cceEeeEeeecccccceeecccccc
Q 046926           42 NAWISYNSSTHNLSVAFTGFRNNSVVMQGLDY-QVDLRLHLP-EFVTFGFSMATGVDFAIFSIYSWEF  107 (226)
Q Consensus        42 ~~~i~y~~~~~~l~v~~~~~~~~~~~~~~l~~-~~~Ls~~l~-~~v~vGFsastg~~~~~~~il~W~f  107 (226)
                      ++.|.|......|.|.+..       +.++.. .+.    || .-.|+||+|+||...+.|.|++..+
T Consensus       155 ~iri~Y~~~~~~l~v~vd~-------~~Cf~~~~v~----lP~~~y~fGiSAaTg~~~d~hdIl~~~~  211 (215)
T cd06903         155 TIRLSYDALNSLFKVQVDN-------RLCFQTDKVQ----LPQGGYRFGITAANADNPESFEILKLKV  211 (215)
T ss_pred             EEEEEEECCCCEEEEEECC-------CEEEecCCee----cCCCCCEEEEEEcCCCCCCcEEEEEEEE
Confidence            7888888766677777632       123332 233    45 4567999999999989999987543


No 14 
>cd06901 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembrane proteins, lectin domain. The vesicular integral protein of 36 kDa (VIP36) is a type 1 transmembrane protein of the mammalian early secretory pathway that acts as a cargo receptor transporting high mannose type glycoproteins between the Golgi and the endoplasmic reticulum (ER).  Lectins of the early secretory pathway are involved in the selective transport of newly synthesized glycoproteins from the ER to the ER-Golgi intermediate compartment (ERGIC). The most prominent cycling lectin is the mannose-binding type1 membrane protein ERGIC-53, which functions as a cargo receptor to facilitate export of glycoproteins from the ER. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face".  This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded she
Probab=95.56  E-value=0.14  Score=42.60  Aligned_cols=62  Identities=26%  Similarity=0.173  Sum_probs=40.5

Q ss_pred             eEEEEEcCCCcEEEEEEEeCCCCCcccceeEEEeccccCCCcceEeeEeeecccccceeecccccccC
Q 046926           42 NAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNS  109 (226)
Q Consensus        42 ~~~i~y~~~~~~l~v~~~~~~~~~~~~~~l~~~~~Ls~~l~~~v~vGFsastg~~~~~~~il~W~f~s  109 (226)
                      .++|.|...  .|.|.+...+... -..|+...   .-.||...|+||+|.||...+.|.|++-.+..
T Consensus       161 ~~rI~Y~~~--~l~v~vd~~~~~~-w~~Cf~~~---~v~LP~~~yfGiSA~Tg~~sd~hdIlsv~~~~  222 (248)
T cd06901         161 FVAIRYSKG--RLTVMTDIDGKNE-WKECFDVT---GVRLPTGYYFGASAATGDLSDNHDIISMKLYE  222 (248)
T ss_pred             EEEEEEECC--eEEEEEecCCCCc-eeeeEEeC---CeecCCCCEEEEEecCCCCCCcEEEEEEEEec
Confidence            688999864  4777775533111 12233221   12467778999999999999999998765544


No 15 
>KOG3838 consensus Mannose lectin ERGIC-53, involved in glycoprotein traffic [Intracellular trafficking, secretion, and vesicular transport]
Probab=94.73  E-value=0.36  Score=42.28  Aligned_cols=61  Identities=28%  Similarity=0.215  Sum_probs=45.0

Q ss_pred             eEEEEEcCCCcEEEEEEEeCCCCCcccceeEEEeccccCCCcceEeeEeeecccccceeeccccc
Q 046926           42 NAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWE  106 (226)
Q Consensus        42 ~~~i~y~~~~~~l~v~~~~~~~~~~~~~~l~~~~~Ls~~l~~~v~vGFsastg~~~~~~~il~W~  106 (226)
                      .|.|+|-.  +.|+|.+.....+. ..+-+..+++ .-+||..-|.|.||+||....-|.+++..
T Consensus       191 RarItY~~--nvLtv~innGmtp~-d~yE~C~rve-~~~lp~nGyFGvSAATGgLADDHDVl~Fl  251 (497)
T KOG3838|consen  191 RARITYYG--NVLTVMINNGMTPS-DDYEFCVRVE-NLLLPPNGYFGVSAATGGLADDHDVLSFL  251 (497)
T ss_pred             eEEEEEec--cEEEEEEcCCCCCC-CCcceeEecc-ceeccCCCeeeeeecccccccccceeeeE
Confidence            89999986  57999987655433 3344444443 12568889999999999999999998753


No 16 
>PF04478 Mid2:  Mid2 like cell wall stress sensor;  InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region. The remainder of the protein sequence is serine-rich and of low complexity, and is therefore impossible to align accurately. Mid2 is thought to act as a mechanosensor of cell wall stress. The C-terminal cytoplasmic region of Mid2 is known to interact with Rom2, a guanine nucleotide exchange factor (GEF) for Rho1, which is part of the cell wall integrity signalling pathway [].
Probab=94.72  E-value=0.065  Score=40.81  Aligned_cols=19  Identities=26%  Similarity=0.172  Sum_probs=11.7

Q ss_pred             CcccEEeeehhhHHHHHHH
Q 046926          131 RKAPVVGLSLGGGFLVGGV  149 (226)
Q Consensus       131 ~~~~ii~i~v~~~~~~~~~  149 (226)
                      .+.++||+++|+.+.++++
T Consensus        47 nknIVIGvVVGVGg~ill~   65 (154)
T PF04478_consen   47 NKNIVIGVVVGVGGPILLG   65 (154)
T ss_pred             CccEEEEEEecccHHHHHH
Confidence            3457888887765544433


No 17 
>PLN03224 probable serine/threonine protein kinase; Provisional
Probab=94.71  E-value=0.015  Score=53.29  Aligned_cols=23  Identities=39%  Similarity=0.787  Sum_probs=20.9

Q ss_pred             HhCCCcCCccccCCCcceEEEEe
Q 046926          199 TNDFNDDQKLGQGGFGGVYKGFL  221 (226)
Q Consensus       199 T~~F~~~n~lG~GgfG~VYKG~L  221 (226)
                      +++|...++||+|+||+||||.+
T Consensus       144 ~d~F~i~~~LG~GgFG~VYkG~~  166 (507)
T PLN03224        144 SDDFQLRDKLGGGNFGITFEGLR  166 (507)
T ss_pred             ccCceEeeEeecCCCeEEEEEEe
Confidence            56799999999999999999976


No 18 
>PF14575 EphA2_TM:  Ephrin type-A receptor 2 transmembrane domain; PDB: 3KUL_A 2XVD_A 2VX1_A 2VWV_A 2VX0_A 2VWY_A 2VWZ_A 2VWW_A 2VWU_A 2VWX_A ....
Probab=94.47  E-value=0.011  Score=39.85  Aligned_cols=18  Identities=17%  Similarity=0.416  Sum_probs=14.6

Q ss_pred             ceechHHHHHHHhCCCcC
Q 046926          188 KRFPYKELALATNDFNDD  205 (226)
Q Consensus       188 ~~f~~~el~~AT~~F~~~  205 (226)
                      ..+||+|..+|-..|..+
T Consensus        55 DP~TYEDP~qAV~eFAkE   72 (75)
T PF14575_consen   55 DPHTYEDPNQAVREFAKE   72 (75)
T ss_dssp             -GGGSSSHHHHHHHCSSB
T ss_pred             CcccccCHHHHHHHHHhh
Confidence            457899999999999863


No 19 
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=93.99  E-value=0.054  Score=50.45  Aligned_cols=27  Identities=44%  Similarity=0.704  Sum_probs=22.9

Q ss_pred             HHhCCCcCCccccCCCcceEEEEeCCC
Q 046926          198 ATNDFNDDQKLGQGGFGGVYKGFLRET  224 (226)
Q Consensus       198 AT~~F~~~n~lG~GgfG~VYKG~L~~~  224 (226)
                      ..++|...++||+|+||.||+|++.+.
T Consensus       130 ~~~~y~l~~~LG~G~FG~VYka~~~~~  156 (566)
T PLN03225        130 KKDDFVLGKKLGEGAFGVVYKASLVNK  156 (566)
T ss_pred             ccCCeEEeEEEeeCCCeEEEEEEEcCC
Confidence            456788888999999999999998654


No 20 
>PTZ00382 Variant-specific surface protein (VSP); Provisional
Probab=93.84  E-value=0.086  Score=37.25  Aligned_cols=23  Identities=26%  Similarity=0.410  Sum_probs=14.1

Q ss_pred             CCCCcccEEeeehhhHHHHHHHH
Q 046926          128 RKNRKAPVVGLSLGGGFLVGGVV  150 (226)
Q Consensus       128 ~~~~~~~ii~i~v~~~~~~~~~~  150 (226)
                      ...+...++++++++++++.+++
T Consensus        61 ~~ls~gaiagi~vg~~~~v~~lv   83 (96)
T PTZ00382         61 SGLSTGAIAGISVAVVAVVGGLV   83 (96)
T ss_pred             CCcccccEEEEEeehhhHHHHHH
Confidence            34556678888877665554443


No 21 
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms]
Probab=93.79  E-value=0.089  Score=46.94  Aligned_cols=20  Identities=35%  Similarity=0.775  Sum_probs=17.2

Q ss_pred             CCccccCCCcceEEEEeCCC
Q 046926          205 DQKLGQGGFGGVYKGFLRET  224 (226)
Q Consensus       205 ~n~lG~GgfG~VYKG~L~~~  224 (226)
                      -..||+|.||.|.||...++
T Consensus       216 ~e~IGkGRyGEVwrG~wrGe  235 (513)
T KOG2052|consen  216 QEIIGKGRFGEVWRGRWRGE  235 (513)
T ss_pred             EEEecCccccceeeccccCC
Confidence            45899999999999988765


No 22 
>KOG3839 consensus Lectin VIP36, involved in the transport of glycoproteins carrying high mannose-type glycans [Intracellular trafficking, secretion, and vesicular transport]
Probab=93.49  E-value=0.29  Score=41.93  Aligned_cols=59  Identities=24%  Similarity=0.108  Sum_probs=40.7

Q ss_pred             eEEEEEcCCCcEEEEEEEeCCCCCcccceeEEEecccc-CCCcceEeeEeeecccccceeecccccc
Q 046926           42 NAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRL-HLPEFVTFGFSMATGVDFAIFSIYSWEF  107 (226)
Q Consensus        42 ~~~i~y~~~~~~l~v~~~~~~~~~~~~~~l~~~~~Ls~-~l~~~v~vGFsastg~~~~~~~il~W~f  107 (226)
                      .+-|.|+.  +.|++.....+   |..  +..-.+|.. .+|.--|+|++|+||+..+.|.+++-.+
T Consensus       213 ~~~iry~~--~~l~~~~dl~~---~~~--~~~c~~~n~v~lp~g~~fg~SasTGdlSd~HdivS~kl  272 (351)
T KOG3839|consen  213 LVVIRYEK--KTLSISIDLEG---PNE--WIDCFSLNNVELPLGYFFGVSASTGDLSDSHDIVSLKL  272 (351)
T ss_pred             eeEEEecC--CceEEEEecCC---Cce--eeeeeeecceecccceEEeeeeccCccchhhHHHHhhh
Confidence            68888988  56777665543   222  222334444 5677789999999999999999876544


No 23 
>PF06697 DUF1191:  Protein of unknown function (DUF1191);  InterPro: IPR010605 This family contains hypothetical plant proteins of unknown function.
Probab=90.96  E-value=1  Score=37.86  Aligned_cols=8  Identities=25%  Similarity=-0.006  Sum_probs=3.4

Q ss_pred             EEEecccc
Q 046926           72 DYQVDLRL   79 (226)
Q Consensus        72 ~~~~~Ls~   79 (226)
                      ...+|+.+
T Consensus       158 Cv~F~~~G  165 (278)
T PF06697_consen  158 CVTFDLDG  165 (278)
T ss_pred             EEEEcCCC
Confidence            33444443


No 24 
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms]
Probab=90.68  E-value=0.12  Score=47.82  Aligned_cols=18  Identities=39%  Similarity=0.924  Sum_probs=15.6

Q ss_pred             CccccCCCcceEEEEeCC
Q 046926          206 QKLGQGGFGGVYKGFLRE  223 (226)
Q Consensus       206 n~lG~GgfG~VYKG~L~~  223 (226)
                      ..||+|.||+||||..-+
T Consensus       398 ~rIGsGsFGtV~Rg~whG  415 (678)
T KOG0193|consen  398 ERIGSGSFGTVYRGRWHG  415 (678)
T ss_pred             ceeccccccceeeccccc
Confidence            489999999999997643


No 25 
>PF15102 TMEM154:  TMEM154 protein family
Probab=87.65  E-value=0.63  Score=35.27  Aligned_cols=7  Identities=29%  Similarity=0.420  Sum_probs=3.3

Q ss_pred             echHHHH
Q 046926          190 FPYKELA  196 (226)
Q Consensus       190 f~~~el~  196 (226)
                      +.++||-
T Consensus       125 iEmeeld  131 (146)
T PF15102_consen  125 IEMEELD  131 (146)
T ss_pred             hhHHHHH
Confidence            3445553


No 26 
>PTZ00284 protein kinase; Provisional
Probab=86.96  E-value=0.18  Score=45.48  Aligned_cols=31  Identities=29%  Similarity=0.539  Sum_probs=23.8

Q ss_pred             HHHHHHHhCCCcCCccccCCCcceEEEEeCC
Q 046926          193 KELALATNDFNDDQKLGQGGFGGVYKGFLRE  223 (226)
Q Consensus       193 ~el~~AT~~F~~~n~lG~GgfG~VYKG~L~~  223 (226)
                      +++...++.|.-.++||+|+||+||++....
T Consensus       122 ~~~~~~~~~y~i~~~lG~G~fg~V~~a~~~~  152 (467)
T PTZ00284        122 EDIDVSTQRFKILSLLGEGTFGKVVEAWDRK  152 (467)
T ss_pred             CccccCCCcEEEEEEEEeccCEEEEEEEEcC
Confidence            3444455667777899999999999998654


No 27 
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis]
Probab=86.87  E-value=0.39  Score=47.88  Aligned_cols=23  Identities=48%  Similarity=0.718  Sum_probs=18.4

Q ss_pred             HHhCCCcCCccccCCCcceEEEE
Q 046926          198 ATNDFNDDQKLGQGGFGGVYKGF  220 (226)
Q Consensus       198 AT~~F~~~n~lG~GgfG~VYKG~  220 (226)
                      -.+.|-+=.+||+||||.|||..
T Consensus       477 Y~~DFEEL~lLGkGGFG~VvkVR  499 (1351)
T KOG1035|consen  477 YLNDFEELELLGKGGFGSVVKVR  499 (1351)
T ss_pred             HhhhhHHHHHhcCCCCceEEEEe
Confidence            34456666799999999999985


No 28 
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms]
Probab=86.60  E-value=1  Score=40.03  Aligned_cols=25  Identities=32%  Similarity=0.558  Sum_probs=20.6

Q ss_pred             hCCCcCCccccCCCcceEEEEeCCC
Q 046926          200 NDFNDDQKLGQGGFGGVYKGFLRET  224 (226)
Q Consensus       200 ~~F~~~n~lG~GgfG~VYKG~L~~~  224 (226)
                      .-|.-..++-+|.||.||+|.+.++
T Consensus       284 ~Rv~l~~llqEGtFGri~~gI~~eE  308 (563)
T KOG1024|consen  284 CRVRLSCLLQEGTFGRIYRGIWREE  308 (563)
T ss_pred             hheechhhhhcCchhheeeeeeccc
Confidence            3466677999999999999988765


No 29 
>PF15065 NCU-G1:  Lysosomal transcription factor, NCU-G1
Probab=86.48  E-value=0.3  Score=42.63  Aligned_cols=30  Identities=13%  Similarity=0.186  Sum_probs=23.2

Q ss_pred             eEeeEeeecccccceeecccccccCCCccc
Q 046926           85 VTFGFSMATGVDFAIFSIYSWEFNSSLEMD  114 (226)
Q Consensus        85 v~vGFsastg~~~~~~~il~W~f~s~~~~~  114 (226)
                      +.+=|..+.+.++.-+..++|++..-...|
T Consensus       281 ~nvSFG~~gDgfY~~t~ylsWt~~~G~G~P  310 (350)
T PF15065_consen  281 LNVSFGTSGDGFYWATNYLSWTFLIGYGSP  310 (350)
T ss_pred             EEEEeccCCCCcccccceEEEEEecccCCC
Confidence            666688888888888999999997654433


No 30 
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms]
Probab=85.88  E-value=0.43  Score=43.41  Aligned_cols=18  Identities=56%  Similarity=1.032  Sum_probs=16.2

Q ss_pred             CccccCCCcceEEEEeCC
Q 046926          206 QKLGQGGFGGVYKGFLRE  223 (226)
Q Consensus       206 n~lG~GgfG~VYKG~L~~  223 (226)
                      .+||+|.||.||+|.|.-
T Consensus       163 kkLGeGaFGeV~~G~l~~  180 (474)
T KOG0194|consen  163 KKLGEGAFGEVFKGKLKL  180 (474)
T ss_pred             ceeecccccEEEEEEEEe
Confidence            599999999999999864


No 31 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=85.68  E-value=0.26  Score=36.32  Aligned_cols=17  Identities=18%  Similarity=0.186  Sum_probs=7.8

Q ss_pred             CcccEEeeehhhHHHHH
Q 046926          131 RKAPVVGLSLGGGFLVG  147 (226)
Q Consensus       131 ~~~~ii~i~v~~~~~~~  147 (226)
                      ....+++|++|+++.++
T Consensus        62 s~~~i~~Ii~gv~aGvI   78 (122)
T PF01102_consen   62 SEPAIIGIIFGVMAGVI   78 (122)
T ss_dssp             S-TCHHHHHHHHHHHHH
T ss_pred             cccceeehhHHHHHHHH
Confidence            33445555555544333


No 32 
>PF03302 VSP:  Giardia variant-specific surface protein;  InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein).
Probab=85.65  E-value=0.91  Score=40.45  Aligned_cols=28  Identities=21%  Similarity=0.364  Sum_probs=18.8

Q ss_pred             CCCCCcccEEeeehhhHHHHHHHHHHHH
Q 046926          127 RRKNRKAPVVGLSLGGGFLVGGVVLIIR  154 (226)
Q Consensus       127 ~~~~~~~~ii~i~v~~~~~~~~~~~~~~  154 (226)
                      ++.++...|++|+|++++++-.|+.|+.
T Consensus       361 ~s~LstgaIaGIsvavvvvVgglvGfLc  388 (397)
T PF03302_consen  361 KSGLSTGAIAGISVAVVVVVGGLVGFLC  388 (397)
T ss_pred             cccccccceeeeeehhHHHHHHHHHHHh
Confidence            4456778888988877766655555444


No 33 
>PTZ00036 glycogen synthase kinase; Provisional
Probab=83.01  E-value=0.58  Score=42.02  Aligned_cols=26  Identities=27%  Similarity=0.583  Sum_probs=20.5

Q ss_pred             hCCCcCCccccCCCcceEEEEeCCCC
Q 046926          200 NDFNDDQKLGQGGFGGVYKGFLRETN  225 (226)
Q Consensus       200 ~~F~~~n~lG~GgfG~VYKG~L~~~~  225 (226)
                      +.|.-.++||+|+||.||+|...+.+
T Consensus        66 ~~y~~~~~LG~G~fg~Vy~~~~~~~~   91 (440)
T PTZ00036         66 KSYKLGNIIGNGSFGVVYEAICIDTS   91 (440)
T ss_pred             CeEEEeEEEEeCCCEEEEEEEECCCC
Confidence            34666779999999999999875543


No 34 
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated
Probab=82.39  E-value=0.67  Score=42.80  Aligned_cols=27  Identities=19%  Similarity=0.194  Sum_probs=20.8

Q ss_pred             HHhCCCcCCccccCCCcceEEEEeCCC
Q 046926          198 ATNDFNDDQKLGQGGFGGVYKGFLRET  224 (226)
Q Consensus       198 AT~~F~~~n~lG~GgfG~VYKG~L~~~  224 (226)
                      .+..+...++||+|+||+||+|.+.+.
T Consensus       331 ~~~~~~~~~~iG~G~~g~Vy~~~~~~~  357 (535)
T PRK09605        331 VKRRKIPDHLIGKGAEADIKKGEYLGR  357 (535)
T ss_pred             cccccCccceeccCCcEEEEEEeecCc
Confidence            344456678999999999999887543


No 35 
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=81.54  E-value=2.2  Score=40.97  Aligned_cols=19  Identities=32%  Similarity=0.574  Sum_probs=16.4

Q ss_pred             CccccCCCcceEEEEeCCC
Q 046926          206 QKLGQGGFGGVYKGFLRET  224 (226)
Q Consensus       206 n~lG~GgfG~VYKG~L~~~  224 (226)
                      ..||+|.||.||+|.+.+.
T Consensus       492 ~eLGegaFGkVf~a~~~~l  510 (774)
T KOG1026|consen  492 EELGEGAFGKVFLAEAYGL  510 (774)
T ss_pred             hhhcCchhhhhhhhhccCC
Confidence            4899999999999988653


No 36 
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an
Probab=81.52  E-value=0.63  Score=40.69  Aligned_cols=34  Identities=24%  Similarity=0.436  Sum_probs=25.7

Q ss_pred             hHHHHHHHhCCCcCCccccCCCcceEEEEeCCCC
Q 046926          192 YKELALATNDFNDDQKLGQGGFGGVYKGFLRETN  225 (226)
Q Consensus       192 ~~el~~AT~~F~~~n~lG~GgfG~VYKG~L~~~~  225 (226)
                      +.++....++|.-...||+|+||.||++.....+
T Consensus        35 ~~~~~~~~~~y~i~~~lG~G~fg~Vy~~~~~~~~   68 (371)
T cd05622          35 IRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTR   68 (371)
T ss_pred             HhhcCcchhhcEEEEEEeecCCeEEEEEEECCCC
Confidence            3444555567888889999999999999876543


No 37 
>PF12877 DUF3827:  Domain of unknown function (DUF3827);  InterPro: IPR024606 The function of the proteins in this entry is not currently known, but one of the human proteins (Q9HCM3 from SWISSPROT) has been implicated in pilocytic astrocytomas [, , ]. In the majority of cases of pilocytic astrocytomas a tandem duplication produces an in-frame fusion of the gene encoding this protein and the BRAF oncogene. The resulting fusion protein has constitutive BRAF kinase activity and is capable of transforming cells. 
Probab=80.80  E-value=1.6  Score=40.82  Aligned_cols=23  Identities=9%  Similarity=-0.036  Sum_probs=11.7

Q ss_pred             CCCCcccEEeeehhhHHHHHHHH
Q 046926          128 RKNRKAPVVGLSLGGGFLVGGVV  150 (226)
Q Consensus       128 ~~~~~~~ii~i~v~~~~~~~~~~  150 (226)
                      .....|+++|+++.+++++++++
T Consensus       265 ~~~NlWII~gVlvPv~vV~~Iii  287 (684)
T PF12877_consen  265 PPNNLWIIAGVLVPVLVVLLIII  287 (684)
T ss_pred             CCCCeEEEehHhHHHHHHHHHHH
Confidence            34456666666554444433333


No 38 
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit. Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce
Probab=80.65  E-value=0.79  Score=40.09  Aligned_cols=20  Identities=30%  Similarity=0.512  Sum_probs=16.0

Q ss_pred             CCcCCccccCCCcceEEEEe
Q 046926          202 FNDDQKLGQGGFGGVYKGFL  221 (226)
Q Consensus       202 F~~~n~lG~GgfG~VYKG~L  221 (226)
                      |.-...||+|+||.||++..
T Consensus        37 ~~~~~~LG~G~fG~V~~~~~   56 (375)
T cd05104          37 LSFGKTLGAGAFGKVVEATA   56 (375)
T ss_pred             eehhheecCCccceEEEEEE
Confidence            33356999999999999863


No 39 
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms]
Probab=79.96  E-value=0.99  Score=39.73  Aligned_cols=19  Identities=58%  Similarity=0.941  Sum_probs=16.2

Q ss_pred             CccccCCCcceEEEEeCCC
Q 046926          206 QKLGQGGFGGVYKGFLRET  224 (226)
Q Consensus       206 n~lG~GgfG~VYKG~L~~~  224 (226)
                      +.||+|+||+||||...+.
T Consensus        47 ~~iG~G~~g~V~~~~~~g~   65 (362)
T KOG0192|consen   47 EVLGSGSFGTVYKGKWRGT   65 (362)
T ss_pred             hhcccCCceeEEEEEeCCc
Confidence            3599999999999988653


No 40 
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found 
Probab=79.59  E-value=0.78  Score=40.14  Aligned_cols=26  Identities=23%  Similarity=0.436  Sum_probs=20.8

Q ss_pred             HhCCCcCCccccCCCcceEEEEeCCC
Q 046926          199 TNDFNDDQKLGQGGFGGVYKGFLRET  224 (226)
Q Consensus       199 T~~F~~~n~lG~GgfG~VYKG~L~~~  224 (226)
                      .++|.-.++||+|+||.||++.....
T Consensus        42 ~~~y~~~~~lG~G~fg~Vy~~~~~~~   67 (370)
T cd05621          42 AEDYDVVKVIGRGAFGEVQLVRHKSS   67 (370)
T ss_pred             HHHCeEEEEEEecCCeEEEEEEECCC
Confidence            45566677999999999999987654


No 41 
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms]
Probab=79.35  E-value=1.1  Score=40.62  Aligned_cols=26  Identities=42%  Similarity=0.649  Sum_probs=21.9

Q ss_pred             hCCCcCCccccCCCcceEEEEeCCCC
Q 046926          200 NDFNDDQKLGQGGFGGVYKGFLRETN  225 (226)
Q Consensus       200 ~~F~~~n~lG~GgfG~VYKG~L~~~~  225 (226)
                      +.|..-++||+||||.||-....+.|
T Consensus       185 n~F~~~RvlGkGGFGEV~acqvraTG  210 (591)
T KOG0986|consen  185 NTFRVYRVLGKGGFGEVCACQVRATG  210 (591)
T ss_pred             cceeeeEEEecccccceeEEEEecch
Confidence            34888899999999999988777665


No 42 
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via in
Probab=78.94  E-value=0.59  Score=40.81  Aligned_cols=26  Identities=27%  Similarity=0.448  Sum_probs=20.8

Q ss_pred             HhCCCcCCccccCCCcceEEEEeCCC
Q 046926          199 TNDFNDDQKLGQGGFGGVYKGFLRET  224 (226)
Q Consensus       199 T~~F~~~n~lG~GgfG~VYKG~L~~~  224 (226)
                      .++|.-.++||+|+||.||++.....
T Consensus        42 ~~~y~~~~~lg~G~~g~Vy~~~~~~~   67 (370)
T cd05596          42 AEDFDVIKVIGRGAFGEVQLVRHKSS   67 (370)
T ss_pred             HHHcEEEEEEeeCCCEEEEEEEECCC
Confidence            34577777999999999999987654


No 43 
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=78.44  E-value=1.3  Score=38.21  Aligned_cols=20  Identities=40%  Similarity=0.574  Sum_probs=16.6

Q ss_pred             CCccccCCCcceEEEEeCCC
Q 046926          205 DQKLGQGGFGGVYKGFLRET  224 (226)
Q Consensus       205 ~n~lG~GgfG~VYKG~L~~~  224 (226)
                      .++||+|+||+||++.....
T Consensus        79 ~~~lg~G~~g~V~~~~~~~~   98 (353)
T PLN00034         79 VNRIGSGAGGTVYKVIHRPT   98 (353)
T ss_pred             hhhccCCCCeEEEEEEECCC
Confidence            35899999999999987543


No 44 
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-
Probab=77.61  E-value=1.6  Score=38.79  Aligned_cols=20  Identities=35%  Similarity=0.541  Sum_probs=16.2

Q ss_pred             CCcCCccccCCCcceEEEEe
Q 046926          202 FNDDQKLGQGGFGGVYKGFL  221 (226)
Q Consensus       202 F~~~n~lG~GgfG~VYKG~L  221 (226)
                      |.-.++||+|+||.||+|+.
T Consensus        39 ~~~~~~LG~G~fG~Vy~~~~   58 (400)
T cd05105          39 LVLGRILGSGAFGKVVEGTA   58 (400)
T ss_pred             eehhheecCCCCceEEEEEE
Confidence            33345999999999999975


No 45 
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=77.61  E-value=0.73  Score=41.61  Aligned_cols=14  Identities=29%  Similarity=0.548  Sum_probs=0.0

Q ss_pred             cEEeeehhhHHHHH
Q 046926          134 PVVGLSLGGGFLVG  147 (226)
Q Consensus       134 ~ii~i~v~~~~~~~  147 (226)
                      ++++++++++++++
T Consensus       353 ~~l~vVlgvavliv  366 (439)
T PF02480_consen  353 ALLGVVLGVAVLIV  366 (439)
T ss_dssp             --------------
T ss_pred             chHHHHHHHHHHHH
Confidence            33334434443333


No 46 
>PHA03209 serine/threonine kinase US3; Provisional
Probab=77.22  E-value=1.6  Score=37.77  Aligned_cols=27  Identities=19%  Similarity=0.177  Sum_probs=22.1

Q ss_pred             HHhCCCcCCccccCCCcceEEEEeCCC
Q 046926          198 ATNDFNDDQKLGQGGFGGVYKGFLRET  224 (226)
Q Consensus       198 AT~~F~~~n~lG~GgfG~VYKG~L~~~  224 (226)
                      ...+|.-...||+|+||.||+|.....
T Consensus        64 ~~~~y~~~~~lg~G~~g~Vy~~~~~~~   90 (357)
T PHA03209         64 ASLGYTVIKTLTPGSEGRVFVATKPGQ   90 (357)
T ss_pred             hhcCcEEEEEecCCCCeEEEEEEECCC
Confidence            345688888999999999999987654


No 47 
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti
Probab=77.11  E-value=1.5  Score=38.33  Aligned_cols=20  Identities=30%  Similarity=0.509  Sum_probs=16.7

Q ss_pred             CCcCCccccCCCcceEEEEe
Q 046926          202 FNDDQKLGQGGFGGVYKGFL  221 (226)
Q Consensus       202 F~~~n~lG~GgfG~VYKG~L  221 (226)
                      |.-.++||+|+||.||++..
T Consensus        40 ~~~~~~LG~G~fg~V~~~~~   59 (374)
T cd05106          40 LQFGKTLGAGAFGKVVEATA   59 (374)
T ss_pred             ceehheecCCCcccEEEEEE
Confidence            55566999999999999874


No 48 
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms]
Probab=76.77  E-value=1.4  Score=43.60  Aligned_cols=20  Identities=40%  Similarity=0.785  Sum_probs=17.2

Q ss_pred             CCccccCCCcceEEEEeCCC
Q 046926          205 DQKLGQGGFGGVYKGFLRET  224 (226)
Q Consensus       205 ~n~lG~GgfG~VYKG~L~~~  224 (226)
                      .+.||+|.||.||+|.+.+.
T Consensus       697 ~~~lG~G~FG~VY~g~~~~~  716 (1025)
T KOG1095|consen  697 LRVLGKGAFGEVYEGTYSDV  716 (1025)
T ss_pred             eeeeccccccceEEEEEecC
Confidence            45899999999999998653


No 49 
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D
Probab=76.77  E-value=1.5  Score=39.00  Aligned_cols=21  Identities=29%  Similarity=0.464  Sum_probs=17.1

Q ss_pred             CCcCCccccCCCcceEEEEeC
Q 046926          202 FNDDQKLGQGGFGGVYKGFLR  222 (226)
Q Consensus       202 F~~~n~lG~GgfG~VYKG~L~  222 (226)
                      +.-..+||+|+||.||+|...
T Consensus        39 ~~~~~~lG~G~fG~Vy~~~~~   59 (401)
T cd05107          39 LVLGRTLGSGAFGRVVEATAH   59 (401)
T ss_pred             eehhhhccCCCceeEEEEEEc
Confidence            344559999999999999864


No 50 
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only]
Probab=76.66  E-value=0.77  Score=39.89  Aligned_cols=21  Identities=24%  Similarity=0.559  Sum_probs=17.5

Q ss_pred             CCCcCCccccCCCcceEEEEe
Q 046926          201 DFNDDQKLGQGGFGGVYKGFL  221 (226)
Q Consensus       201 ~F~~~n~lG~GgfG~VYKG~L  221 (226)
                      +|..-|+|++|.||.||||.=
T Consensus        77 efe~lnrI~EGtyGiVYRakd   97 (419)
T KOG0663|consen   77 EFEKLNRIEEGTYGVVYRAKD   97 (419)
T ss_pred             HHHHHhhcccCcceeEEEecc
Confidence            466668999999999999963


No 51 
>PHA03211 serine/threonine kinase US3; Provisional
Probab=76.54  E-value=1.8  Score=39.30  Aligned_cols=24  Identities=21%  Similarity=0.282  Sum_probs=19.3

Q ss_pred             CCCcCCccccCCCcceEEEEeCCC
Q 046926          201 DFNDDQKLGQGGFGGVYKGFLRET  224 (226)
Q Consensus       201 ~F~~~n~lG~GgfG~VYKG~L~~~  224 (226)
                      +|.-..+||+|+||.||++.....
T Consensus       170 gy~i~~~Lg~G~~G~Vy~a~~~~~  193 (461)
T PHA03211        170 GFAIHRALTPGSEGCVFESSHPDY  193 (461)
T ss_pred             CeEEEEEEccCCCeEEEEEEECCC
Confidence            355567899999999999987654


No 52 
>PHA03210 serine/threonine kinase US3; Provisional
Probab=75.61  E-value=1.7  Score=39.79  Aligned_cols=23  Identities=30%  Similarity=0.499  Sum_probs=18.8

Q ss_pred             hCCCcCCccccCCCcceEEEEeC
Q 046926          200 NDFNDDQKLGQGGFGGVYKGFLR  222 (226)
Q Consensus       200 ~~F~~~n~lG~GgfG~VYKG~L~  222 (226)
                      +.|.-..+||+|+||+||++.+.
T Consensus       148 ~~Y~ii~~LG~G~fG~Vyl~~~~  170 (501)
T PHA03210        148 AHFRVIDDLPAGAFGKIFICALR  170 (501)
T ss_pred             hccEEEeEecCCCCcceEEEEEe
Confidence            45666779999999999998653


No 53 
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms]
Probab=72.87  E-value=17  Score=34.29  Aligned_cols=25  Identities=28%  Similarity=0.209  Sum_probs=18.2

Q ss_pred             eEEEEEecccCCCCCCCCeeEEEcCCCCcc
Q 046926           11 FVAVESDVYVNSWDPTFSHVGVDINSVQSK   40 (226)
Q Consensus        11 ~~avefdt~~n~~d~~~~hvgi~~n~~~s~   40 (226)
                      -++-|||+.+|.     .-|-|..|.+.+.
T Consensus       263 ei~FEF~~~rnf-----s~~~vhtnNmf~k  287 (807)
T KOG1094|consen  263 EIEFEFDELRNF-----SAMQVHTNNMFTK  287 (807)
T ss_pred             EEEEEhhhhccc-----ceeEEeccccccc
Confidence            467789998884     4477788887754


No 54 
>PF15345 TMEM51:  Transmembrane protein 51
Probab=70.18  E-value=11  Score=30.91  Aligned_cols=8  Identities=25%  Similarity=0.339  Sum_probs=4.9

Q ss_pred             echHHHHH
Q 046926          190 FPYKELAL  197 (226)
Q Consensus       190 f~~~el~~  197 (226)
                      -+|+|.+.
T Consensus       125 PSYEEvv~  132 (233)
T PF15345_consen  125 PSYEEVVN  132 (233)
T ss_pred             CChHHHHh
Confidence            36777654


No 55 
>KOG4258 consensus Insulin/growth factor receptor (contains protein kinase domain) [Signal transduction mechanisms]
Probab=70.00  E-value=3.5  Score=39.89  Aligned_cols=22  Identities=41%  Similarity=0.706  Sum_probs=17.2

Q ss_pred             CCcCCccccCCCcceEEEEeCC
Q 046926          202 FNDDQKLGQGGFGGVYKGFLRE  223 (226)
Q Consensus       202 F~~~n~lG~GgfG~VYKG~L~~  223 (226)
                      ....+.||+|+||+||-|.-.+
T Consensus       996 it~~relg~gsfg~Vy~g~~nn 1017 (1025)
T KOG4258|consen  996 ITLGRELGQGSFGMVYEGNANN 1017 (1025)
T ss_pred             HhhhhhhccCccceEEEecCCc
Confidence            4445689999999999886543


No 56 
>PF06365 CD34_antigen:  CD34/Podocalyxin family;  InterPro: IPR013836 This family consists of several mammalian CD34 antigen proteins. The CD34 antigen is a human leukocyte membrane protein expressed specifically by lymphohematopoietic progenitor cells. CD34 is a phosphoprotein. Activation of protein kinase C (PKC) has been found to enhance CD34 phosphorylation [, ]. This family contains several eukaryotic podocalyxin proteins. Podocalyxin is a major membrane protein of the glomerular epithelium and is thought to be involved in maintenance of the architecture of the foot processes and filtration slits characteristic of this unique epithelium by virtue of its high negative charge. Podocalyxin functions as an anti-adhesin that maintains an open filtration pathway between neighbouring foot processes in the glomerular epithelium by charge repulsion [].
Probab=69.94  E-value=6.4  Score=31.69  Aligned_cols=10  Identities=20%  Similarity=0.484  Sum_probs=5.5

Q ss_pred             ccEEeeehhh
Q 046926          133 APVVGLSLGG  142 (226)
Q Consensus       133 ~~ii~i~v~~  142 (226)
                      .++|++++.+
T Consensus       100 ~~lI~lv~~g  109 (202)
T PF06365_consen  100 PTLIALVTSG  109 (202)
T ss_pred             eEEEehHHhh
Confidence            3566665554


No 57 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=69.60  E-value=2  Score=31.96  Aligned_cols=8  Identities=0%  Similarity=-0.143  Sum_probs=3.8

Q ss_pred             eeeccCCc
Q 046926          159 GRKRKEGD  166 (226)
Q Consensus       159 ~~r~~~~~  166 (226)
                      +++++|++
T Consensus        20 ~~~~rRR~   27 (130)
T PF12273_consen   20 YCHNRRRR   27 (130)
T ss_pred             HHHHHHHh
Confidence            44555544


No 58 
>PF08374 Protocadherin:  Protocadherin;  InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains. They are expressed in a variety of organisms and are found in high concentrations in the brain where they seem to be localised mainly at cell-cell contact sites. Their expression seems to be developmentally regulated []. 
Probab=68.93  E-value=4.9  Score=32.52  Aligned_cols=21  Identities=5%  Similarity=-0.015  Sum_probs=12.0

Q ss_pred             CcccEEeeehhhHHHHHHHHH
Q 046926          131 RKAPVVGLSLGGGFLVGGVVL  151 (226)
Q Consensus       131 ~~~~ii~i~v~~~~~~~~~~~  151 (226)
                      ...+++++++|++.+++++++
T Consensus        36 ~~~I~iaiVAG~~tVILVI~i   56 (221)
T PF08374_consen   36 YVKIMIAIVAGIMTVILVIFI   56 (221)
T ss_pred             ceeeeeeeecchhhhHHHHHH
Confidence            445667777666655544433


No 59 
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair]
Probab=68.32  E-value=1.4  Score=39.01  Aligned_cols=25  Identities=36%  Similarity=0.598  Sum_probs=21.0

Q ss_pred             HhCCCcCCccccCCCcceEEEEeCC
Q 046926          199 TNDFNDDQKLGQGGFGGVYKGFLRE  223 (226)
Q Consensus       199 T~~F~~~n~lG~GgfG~VYKG~L~~  223 (226)
                      .+.+...++||+|.|++||++++..
T Consensus        35 ~~~~~~v~kigeGsFssv~~a~~~~   59 (418)
T KOG1167|consen   35 SNAYKVVNKIGEGSFSSVYKATDIE   59 (418)
T ss_pred             hhhhhhhccccccchhhhhhhhHhh
Confidence            3457888999999999999998754


No 60 
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept
Probab=68.14  E-value=2.4  Score=35.57  Aligned_cols=21  Identities=29%  Similarity=0.523  Sum_probs=18.1

Q ss_pred             CCCcCCccccCCCcceEEEEe
Q 046926          201 DFNDDQKLGQGGFGGVYKGFL  221 (226)
Q Consensus       201 ~F~~~n~lG~GgfG~VYKG~L  221 (226)
                      +|.-.++||+|+||.||++..
T Consensus        36 ~~~~~~~ig~G~~g~V~~~~~   56 (302)
T cd05055          36 NLSFGKTLGAGAFGKVVEATA   56 (302)
T ss_pred             HeEEcceeeccCCeeEEEEEE
Confidence            477778999999999999864


No 61 
>PF11770 GAPT:  GRB2-binding adapter (GAPT);  InterPro: IPR021082  This entry represents a family of transmembrane proteins which bind the growth factor receptor-bound protein 2 (GRB2) in B cells []. In contrast to other transmembrane adaptor proteins, GAPT, which this entry represents, is not phosphorylated upon BCR ligation. It associates with GRB2 constitutively through its proline-rich region []. 
Probab=67.93  E-value=1.8  Score=32.92  Aligned_cols=25  Identities=16%  Similarity=0.030  Sum_probs=12.2

Q ss_pred             eeehhhHHHHHHHHHHHHhhhheee
Q 046926          137 GLSLGGGFLVGGVVLIIRLAGIGRK  161 (226)
Q Consensus       137 ~i~v~~~~~~~~~~~~~~~~~~~~r  161 (226)
                      ++++|+.++++++++.+-|+++|++
T Consensus        11 ~i~igi~Ll~lLl~cgiGcvwhwkh   35 (158)
T PF11770_consen   11 AISIGISLLLLLLLCGIGCVWHWKH   35 (158)
T ss_pred             HHHHHHHHHHHHHHHhcceEEEeec
Confidence            3445555555555554444335544


No 62 
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms]
Probab=66.24  E-value=3.1  Score=39.33  Aligned_cols=19  Identities=42%  Similarity=0.945  Sum_probs=16.6

Q ss_pred             CCccccCCCcceEEEEeCC
Q 046926          205 DQKLGQGGFGGVYKGFLRE  223 (226)
Q Consensus       205 ~n~lG~GgfG~VYKG~L~~  223 (226)
                      ..+||+|-||.||+|+..+
T Consensus       394 ~r~iG~GqFGdVy~gvYt~  412 (974)
T KOG4257|consen  394 KRLIGEGQFGDVYKGVYTD  412 (974)
T ss_pred             HHhhcCCcccceeeeEecc
Confidence            4599999999999998754


No 63 
>PF13908 Shisa:  Wnt and FGF inhibitory regulator
Probab=66.01  E-value=3.9  Score=32.04  Aligned_cols=6  Identities=33%  Similarity=0.766  Sum_probs=3.0

Q ss_pred             eEeeec
Q 046926           88 GFSMAT   93 (226)
Q Consensus        88 GFsast   93 (226)
                      ||.-.+
T Consensus        18 ~F~C~~   23 (179)
T PF13908_consen   18 GFNCPE   23 (179)
T ss_pred             CCcCCC
Confidence            555553


No 64 
>PF14991 MLANA:  Protein melan-A; PDB: 2GTZ_F 2GT9_F 3MRO_P 2GUO_C 3MRQ_P 2GTW_C 3L6F_C 3MRP_P.
Probab=65.03  E-value=2  Score=31.01  Aligned_cols=6  Identities=17%  Similarity=0.418  Sum_probs=0.0

Q ss_pred             heeecc
Q 046926          158 IGRKRK  163 (226)
Q Consensus       158 ~~~r~~  163 (226)
                      ++|||.
T Consensus        46 YckRRS   51 (118)
T PF14991_consen   46 YCKRRS   51 (118)
T ss_dssp             ------
T ss_pred             eeeecc
Confidence            445544


No 65 
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only]
Probab=64.53  E-value=4.6  Score=37.09  Aligned_cols=26  Identities=31%  Similarity=0.519  Sum_probs=20.6

Q ss_pred             hCCCcCCccccCCCcceEEEEeCCCC
Q 046926          200 NDFNDDQKLGQGGFGGVYKGFLRETN  225 (226)
Q Consensus       200 ~~F~~~n~lG~GgfG~VYKG~L~~~~  225 (226)
                      +.|.-=..||+|+||.||-+.-.+.|
T Consensus       141 ~DFe~Lk~IgkGAfGeVrLarKk~Tg  166 (550)
T KOG0605|consen  141 DDFELLKVIGKGAFGEVRLARKKDTG  166 (550)
T ss_pred             ccchhheeeccccceeEEEEEEccCC
Confidence            45666668999999999988776655


No 66 
>PF05454 DAG1:  Dystroglycan (Dystrophin-associated glycoprotein 1);  InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5.5 kb transcript in Homo sapiens. The protein product is cleaved into two non-covalently associated subunits, [alpha] (N-terminal) and [beta] (C-terminal). In skeletal muscle the dystroglycan complex works as a transmembrane linkage between the extracellular matrix and the cytoskeleton [alpha]-dystroglycan is extracellular and binds to merosin ([alpha]-2 laminin) in the basement membrane, while [beta]-dystroglycan is a transmembrane protein and binds to dystrophin, which is a large rod-like cytoskeletal protein, absent in Duchenne muscular dystrophy patients. Dystrophin binds to intracellular actin cables. In this way, the dystroglycan complex, which links the extracellular matrix to the intracellular actin cables, is thought to provide structural integrity in muscle tissues. The dystroglycan complex is also known to serve as an agrin receptor in muscle, where it may regulate agrin-induced acetylcholine receptor clustering at the neuromuscular junction. There is also evidence which suggests the function of dystroglycan as a part of the signal transduction pathway because it is shown that Grb2, a mediator of the Ras-related signal pathway, can interact with the cytoplasmic domain of dystroglycan. In general, aberrant expression of dystrophin-associated protein complex underlies the pathogenesis of Duchenne muscular dystrophy, Becker muscular dystrophy and severe childhood autosomal recessive muscular dystrophy. Interestingly, no genetic disease has been described for either [alpha]- or [beta]-dystroglycan. Dystroglycan is widely distributed in non-muscle tissues as well as in muscle tissues. During epithelial morphogenesis of kidney, the dystroglycan complex is shown to act as a receptor for the basement membrane. Dystroglycan expression in Mus musculus brain and neural retina has also been reported. However, the physiological role of dystroglycan in non-muscle tissues has remained unclear [].; PDB: 1EG4_P.
Probab=64.22  E-value=2.2  Score=36.28  Aligned_cols=9  Identities=33%  Similarity=0.353  Sum_probs=0.0

Q ss_pred             CCCCCeeEE
Q 046926           24 DPTFSHVGV   32 (226)
Q Consensus        24 d~~~~hvgi   32 (226)
                      |++.+||-|
T Consensus        34 D~nts~ItV   42 (290)
T PF05454_consen   34 DRNTSSITV   42 (290)
T ss_dssp             ---------
T ss_pred             CCCCCeEEE
Confidence            555555554


No 67 
>PF12191 stn_TNFRSF12A:  Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain;  InterPro: IPR022316 The tumour necrosis factor (TNF) receptor (TNFR) superfamily comprises more than 20 type-I transmembrane proteins. Family members are defined based on similarity in their extracellular domain - a region that contains many cysteine residues arranged in a specific repetitive pattern []. The cysteines allow formation of an extended rod-like structure, responsible for ligand binding []. Upon receptor activation, different intracellular signalling complexes are assembled for different members of the TNFR superfamily, depending on their intracellular domains and sequences []. Activation of TNFRs can therefore induce a range of disparate effects, including cell proliferation, differentiation, survival, or apoptotic cell death, depending upon the receptor involved []. TNFRs are widely distributed and play important roles in many crucial biological processes, such as lymphoid and neuronal development, innate and adaptive immunity, and maintenance of cellular homeostasis []. Drugs that manipulate their signalling have potential roles in the prevention and treatment of many diseases, such as viral infections, coronary heart disease, transplant rejection, and immune disease []. TNF receptor 12 (also known as TWEAK receptor, and fibroblast growth factor-inducible-14 (Fn14)) has been implicated in endothelial cell growth and migration []. The receptor may also play a role in cell-matrix interactions [].; PDB: 2KN0_A 2RPJ_A 2KMZ_A 2EQP_A.
Probab=63.64  E-value=3  Score=30.73  Aligned_cols=17  Identities=18%  Similarity=-0.361  Sum_probs=1.5

Q ss_pred             CCcccEEeeehhhHHHH
Q 046926          130 NRKAPVVGLSLGGGFLV  146 (226)
Q Consensus       130 ~~~~~ii~i~v~~~~~~  146 (226)
                      .+..+.|+..+.+++++
T Consensus        75 ~~l~~pi~~sal~v~lV   91 (129)
T PF12191_consen   75 FPLLWPILGSALSVVLV   91 (129)
T ss_dssp             SSSS-------------
T ss_pred             cceehhhhhhHHHHHHH
Confidence            33334443343333333


No 68 
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning]
Probab=61.74  E-value=2.9  Score=38.18  Aligned_cols=21  Identities=38%  Similarity=0.672  Sum_probs=16.2

Q ss_pred             CCcCCccccCCCcceEEEEeC
Q 046926          202 FNDDQKLGQGGFGGVYKGFLR  222 (226)
Q Consensus       202 F~~~n~lG~GgfG~VYKG~L~  222 (226)
                      |..-.+||+|.||.|||+.=.
T Consensus       119 feki~kIGeGTyg~VYkAr~~  139 (560)
T KOG0600|consen  119 FEKIEKIGEGTYGQVYKARDL  139 (560)
T ss_pred             HHHHHHhcCcchhheeEeeec
Confidence            333448999999999998643


No 69 
>PHA03212 serine/threonine kinase US3; Provisional
Probab=61.19  E-value=5.4  Score=35.21  Aligned_cols=23  Identities=13%  Similarity=0.127  Sum_probs=18.6

Q ss_pred             CCCcCCccccCCCcceEEEEeCC
Q 046926          201 DFNDDQKLGQGGFGGVYKGFLRE  223 (226)
Q Consensus       201 ~F~~~n~lG~GgfG~VYKG~L~~  223 (226)
                      .|.-..+||+|+||.||++.-..
T Consensus        93 ~y~~~~~lg~G~~g~V~~~~d~~  115 (391)
T PHA03212         93 GFSILETFTPGAEGFAFACIDNK  115 (391)
T ss_pred             CcEEEEEEcCCCCeEEEEEEECC
Confidence            46666789999999999997643


No 70 
>PF10577 UPF0560:  Uncharacterised protein family UPF0560;  InterPro: IPR018890  This family of proteins has no known function. 
Probab=61.04  E-value=3.6  Score=39.50  Aligned_cols=9  Identities=11%  Similarity=0.556  Sum_probs=6.4

Q ss_pred             cccccccCC
Q 046926          102 IYSWEFNSS  110 (226)
Q Consensus       102 il~W~f~s~  110 (226)
                      -|-|+|...
T Consensus       235 qLvWty~Ap  243 (807)
T PF10577_consen  235 QLVWTYIAP  243 (807)
T ss_pred             EEEEEEECc
Confidence            467988765


No 71 
>PF01299 Lamp:  Lysosome-associated membrane glycoprotein (Lamp);  InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear. Structurally, the lamp proteins consist of two internally homologous lysosome-luminal domains separated by a proline-rich hinge region; at the C-terminal extremity there is a transmembrane region (TM) followed by a very short cytoplasmic tail (C). In each of the duplicated domains, there are two conserved disulphide bonds. This structure is schematically represented in the figure below.   +-----+ +-----+ +-----+ +-----+ | | | | | | | | xCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxxxCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxx +--------------------------++Hinge++--------------------------++TM++C+  In mammals, there are two closely related types of lamp: lamp-1 and lamp-2, which form major components of the lysosome membrane. In chicken lamp-1 is known as LEP100.  Also included in this entry is the macrophage protein CD68 (or macrosialin) [] is a heavily glycosylated integral membrane protein whose structure consists of a mucin-like domain followed by a proline-rich hinge; a single lamp-like domain; a transmembrane region and a short cytoplasmic tail.   Similar to CD68, mammalian lamp-3, which is expressed in lymphoid organs, dendritic cells and in lung, contains all the C-terminal regions but lacks the N-terminal lamp-like region []. In a lamp-family protein from nematodes [] only the part C-terminal to the hinge is conserved. ; GO: 0016020 membrane
Probab=60.55  E-value=4.3  Score=34.77  Aligned_cols=15  Identities=13%  Similarity=0.135  Sum_probs=7.2

Q ss_pred             cEEeeehhhHHHHHH
Q 046926          134 PVVGLSLGGGFLVGG  148 (226)
Q Consensus       134 ~ii~i~v~~~~~~~~  148 (226)
                      .++-|++|++++.++
T Consensus       271 ~~vPIaVG~~La~lv  285 (306)
T PF01299_consen  271 DLVPIAVGAALAGLV  285 (306)
T ss_pred             chHHHHHHHHHHHHH
Confidence            445555555544333


No 72 
>PF10873 DUF2668:  Protein of unknown function (DUF2668);  InterPro: IPR022640  Members in this family of proteins are annotated as cysteine and tyrosine-rich protein 1, however currently no function is known []. 
Probab=59.02  E-value=15  Score=27.85  Aligned_cols=26  Identities=23%  Similarity=0.285  Sum_probs=15.3

Q ss_pred             CCcccEEeeehhhHHHHHHHHHHHHh
Q 046926          130 NRKAPVVGLSLGGGFLVGGVVLIIRL  155 (226)
Q Consensus       130 ~~~~~ii~i~v~~~~~~~~~~~~~~~  155 (226)
                      .....+.||+.++++++.+++++++|
T Consensus        58 lsgtAIaGIVfgiVfimgvva~i~ic   83 (155)
T PF10873_consen   58 LSGTAIAGIVFGIVFIMGVVAGIAIC   83 (155)
T ss_pred             cccceeeeeehhhHHHHHHHHHHHHH
Confidence            34556777877766665555444443


No 73 
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms]
Probab=58.61  E-value=1.5  Score=39.63  Aligned_cols=16  Identities=56%  Similarity=1.018  Sum_probs=14.0

Q ss_pred             CCccccCCCcceEEEE
Q 046926          205 DQKLGQGGFGGVYKGF  220 (226)
Q Consensus       205 ~n~lG~GgfG~VYKG~  220 (226)
                      -++||+|||..|||+.
T Consensus       468 LhLLGrGGFSEVyKAF  483 (775)
T KOG1151|consen  468 LHLLGRGGFSEVYKAF  483 (775)
T ss_pred             HHHhccccHHHHHHhc
Confidence            3589999999999985


No 74 
>PF14610 DUF4448:  Protein of unknown function (DUF4448)
Probab=57.60  E-value=13  Score=29.48  Aligned_cols=15  Identities=13%  Similarity=0.120  Sum_probs=6.4

Q ss_pred             EEeeehhhHHHHHHH
Q 046926          135 VVGLSLGGGFLVGGV  149 (226)
Q Consensus       135 ii~i~v~~~~~~~~~  149 (226)
                      .++|++.++++++++
T Consensus       159 ~laI~lPvvv~~~~~  173 (189)
T PF14610_consen  159 ALAIALPVVVVVLAL  173 (189)
T ss_pred             eEEEEccHHHHHHHH
Confidence            444444444443333


No 75 
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=55.99  E-value=6.7  Score=37.10  Aligned_cols=26  Identities=42%  Similarity=0.590  Sum_probs=20.7

Q ss_pred             hCCCcCCccccCCCcceEEEEeCCCC
Q 046926          200 NDFNDDQKLGQGGFGGVYKGFLRETN  225 (226)
Q Consensus       200 ~~F~~~n~lG~GgfG~VYKG~L~~~~  225 (226)
                      ++|.=-.+||+|.||+||.+.+...+
T Consensus       368 ~~F~~l~vLGkGsFGkV~lae~k~~~  393 (694)
T KOG0694|consen  368 DDFRLLAVLGRGSFGKVLLAELKGTN  393 (694)
T ss_pred             cceEEEEEeccCcCceEEEEEEcCCC
Confidence            34655669999999999999987654


No 76 
>PHA03265 envelope glycoprotein D; Provisional
Probab=55.53  E-value=11  Score=32.73  Aligned_cols=8  Identities=13%  Similarity=0.272  Sum_probs=4.3

Q ss_pred             CCeeEEEc
Q 046926           27 FSHVGVDI   34 (226)
Q Consensus        27 ~~hvgi~~   34 (226)
                      ++.+|+.+
T Consensus       167 dDELGLvm  174 (402)
T PHA03265        167 DDELGLVL  174 (402)
T ss_pred             ccccceEE
Confidence            45566554


No 77 
>PF12768 Rax2:  Cortical protein marker for cell polarity
Probab=54.01  E-value=16  Score=31.02  Aligned_cols=16  Identities=31%  Similarity=0.210  Sum_probs=8.2

Q ss_pred             CCCCcccEEeeehhhH
Q 046926          128 RKNRKAPVVGLSLGGG  143 (226)
Q Consensus       128 ~~~~~~~ii~i~v~~~  143 (226)
                      ++..++.++.|.++++
T Consensus       222 ~~l~~G~VVlIslAiA  237 (281)
T PF12768_consen  222 KKLSRGFVVLISLAIA  237 (281)
T ss_pred             ccccceEEEEEehHHH
Confidence            3444555655555444


No 78 
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms]
Probab=53.77  E-value=5.4  Score=33.84  Aligned_cols=31  Identities=26%  Similarity=0.446  Sum_probs=20.9

Q ss_pred             ceechHHHHHHHhCCCcCCccccCCCcceEEEEeCCCC
Q 046926          188 KRFPYKELALATNDFNDDQKLGQGGFGGVYKGFLRETN  225 (226)
Q Consensus       188 ~~f~~~el~~AT~~F~~~n~lG~GgfG~VYKG~L~~~~  225 (226)
                      ..|+-++|+.-       ..||.|.||+|+|-.....|
T Consensus        59 ~~F~~~~Lqdl-------g~iG~G~fG~V~KM~hk~sg   89 (361)
T KOG1006|consen   59 HTFTSDNLQDL-------GEIGNGAFGTVNKMLHKPSG   89 (361)
T ss_pred             cccccchHHHH-------HHhcCCcchhhhhhhcCccC
Confidence            44555555432       37999999999997655443


No 79 
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]
Probab=52.42  E-value=6.9  Score=38.88  Aligned_cols=22  Identities=27%  Similarity=0.628  Sum_probs=18.2

Q ss_pred             CCcCCccccCCCcceEEEEeCC
Q 046926          202 FNDDQKLGQGGFGGVYKGFLRE  223 (226)
Q Consensus       202 F~~~n~lG~GgfG~VYKG~L~~  223 (226)
                      |.=+..||+|+||+||+|+=.+
T Consensus       700 ~~I~~e~G~g~y~~vy~a~~~~  721 (974)
T KOG1166|consen  700 FCISKEIGEGSYGSVYVATHSN  721 (974)
T ss_pred             EEEEeeeccccceEEEEeecCC
Confidence            4457789999999999998655


No 80 
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms]
Probab=50.85  E-value=7.9  Score=36.00  Aligned_cols=23  Identities=52%  Similarity=0.878  Sum_probs=17.8

Q ss_pred             CCcCCccccCCCcceEEEEeCCCC
Q 046926          202 FNDDQKLGQGGFGGVYKGFLRETN  225 (226)
Q Consensus       202 F~~~n~lG~GgfG~VYKG~L~~~~  225 (226)
                      |.+ ++||.|-||+||-|.-...|
T Consensus       567 f~d-evLGSGQFG~VYgg~hRktG  589 (888)
T KOG4236|consen  567 FAD-EVLGSGQFGTVYGGKHRKTG  589 (888)
T ss_pred             hhH-hhccCCcceeeecceecccC
Confidence            544 59999999999998765443


No 81 
>PF07213 DAP10:  DAP10 membrane protein;  InterPro: IPR009861 This family consists of several mammalian DAP10 membrane proteins. In activated mouse natural killer (NK) cells, the NKG2D receptor associates with two intracellular adaptors, DAP10 and DAP12, which trigger phosphatidyl inositol 3 kinase (PI3K) and Syk family protein tyrosine kinases, respectively. It has been suggested that the DAP10-PI3K pathway is sufficient to initiate NKG2D-mediated killing of target cells [].
Probab=50.10  E-value=13  Score=25.12  Aligned_cols=21  Identities=10%  Similarity=0.040  Sum_probs=11.3

Q ss_pred             CCCcccEEeeehhhHHHHHHH
Q 046926          129 KNRKAPVVGLSLGGGFLVGGV  149 (226)
Q Consensus       129 ~~~~~~ii~i~v~~~~~~~~~  149 (226)
                      .....+++|++++=+++-+++
T Consensus        30 ~ls~g~LaGiV~~D~vlTLLI   50 (79)
T PF07213_consen   30 PLSPGLLAGIVAADAVLTLLI   50 (79)
T ss_pred             ccCHHHHHHHHHHHHHHHHHH
Confidence            344556666666655544433


No 82 
>PHA03207 serine/threonine kinase US3; Provisional
Probab=49.26  E-value=10  Score=33.21  Aligned_cols=21  Identities=24%  Similarity=0.226  Sum_probs=17.1

Q ss_pred             CCcCCccccCCCcceEEEEeC
Q 046926          202 FNDDQKLGQGGFGGVYKGFLR  222 (226)
Q Consensus       202 F~~~n~lG~GgfG~VYKG~L~  222 (226)
                      |.-...||+|+||.||++...
T Consensus        94 y~i~~~Lg~G~~g~Vy~~~~~  114 (392)
T PHA03207         94 YNILSSLTPGSEGEVFVCTKH  114 (392)
T ss_pred             eEEEEeecCCCCeEEEEEEEc
Confidence            555568999999999998754


No 83 
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms]
Probab=47.63  E-value=14  Score=32.81  Aligned_cols=20  Identities=40%  Similarity=0.627  Sum_probs=16.9

Q ss_pred             CccccCCCcceEEEEeCCCC
Q 046926          206 QKLGQGGFGGVYKGFLRETN  225 (226)
Q Consensus       206 n~lG~GgfG~VYKG~L~~~~  225 (226)
                      .+||+|.||.||+++-...|
T Consensus        41 ~~lG~G~Fg~v~~~~~~~tg   60 (382)
T KOG0032|consen   41 RELGRGQFGVVYLCREKSTG   60 (382)
T ss_pred             hhhCCCCceEEEEEEecCCC
Confidence            59999999999999876543


No 84 
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms]
Probab=47.31  E-value=19  Score=31.65  Aligned_cols=28  Identities=32%  Similarity=0.369  Sum_probs=21.4

Q ss_pred             echHHHHHHHhCCCcCCccccCCCcceEEEEeCCC
Q 046926          190 FPYKELALATNDFNDDQKLGQGGFGGVYKGFLRET  224 (226)
Q Consensus       190 f~~~el~~AT~~F~~~n~lG~GgfG~VYKG~L~~~  224 (226)
                      ++..||.+-       +.||+|..|+|||+.....
T Consensus        76 i~~~dle~~-------~~lG~G~gG~V~kv~Hk~t  103 (364)
T KOG0581|consen   76 ISLSDLERL-------GVLGSGNGGTVYKVRHKPT  103 (364)
T ss_pred             cCHHHhhhh-------hhcccCCCcEEEEEEEcCC
Confidence            566676543       4899999999999987543


No 85 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=46.69  E-value=5.4  Score=29.43  Aligned_cols=12  Identities=17%  Similarity=0.016  Sum_probs=4.9

Q ss_pred             ccEEeeehhhHH
Q 046926          133 APVVGLSLGGGF  144 (226)
Q Consensus       133 ~~ii~i~v~~~~  144 (226)
                      .+++|+++|+++
T Consensus        68 ~Ii~gv~aGvIg   79 (122)
T PF01102_consen   68 GIIFGVMAGVIG   79 (122)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             ehhHHHHHHHHH
Confidence            334444444433


No 86 
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase. This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol - 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species.
Probab=44.99  E-value=14  Score=33.37  Aligned_cols=22  Identities=18%  Similarity=0.335  Sum_probs=18.4

Q ss_pred             CCcCCccccCCCcceEEEEeCCC
Q 046926          202 FNDDQKLGQGGFGGVYKGFLRET  224 (226)
Q Consensus       202 F~~~n~lG~GgfG~VYKG~L~~~  224 (226)
                      |++ +-||.|++|.||||+|.++
T Consensus       120 fd~-~plasaSigQVh~A~l~~G  141 (437)
T TIGR01982       120 FEE-KPLAAASIAQVHRARLVDG  141 (437)
T ss_pred             CCC-cceeeeehhheEEEEecCC
Confidence            553 6799999999999999753


No 87 
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms]
Probab=44.90  E-value=12  Score=34.04  Aligned_cols=19  Identities=37%  Similarity=0.718  Sum_probs=16.7

Q ss_pred             CccccCCCcceEEEEeCCC
Q 046926          206 QKLGQGGFGGVYKGFLRET  224 (226)
Q Consensus       206 n~lG~GgfG~VYKG~L~~~  224 (226)
                      +.||+|-||.|+.|.+.+.
T Consensus       212 ~~LG~G~FG~V~~g~~~~~  230 (468)
T KOG0197|consen  212 RELGSGQFGEVWLGKWNGS  230 (468)
T ss_pred             HHhcCCccceEEEEEEcCC
Confidence            3899999999999998764


No 88 
>PF15176 LRR19-TM:  Leucine-rich repeat family 19 TM domain
Probab=43.57  E-value=18  Score=25.66  Aligned_cols=21  Identities=10%  Similarity=-0.100  Sum_probs=11.7

Q ss_pred             CCCcccEEeeehhhHHHHHHH
Q 046926          129 KNRKAPVVGLSLGGGFLVGGV  149 (226)
Q Consensus       129 ~~~~~~ii~i~v~~~~~~~~~  149 (226)
                      .+.+..++|++++++++-+++
T Consensus        14 g~sW~~LVGVv~~al~~SlLI   34 (102)
T PF15176_consen   14 GRSWPFLVGVVVTALVTSLLI   34 (102)
T ss_pred             CcccHhHHHHHHHHHHHHHHH
Confidence            455566667666655543333


No 89 
>cd06900 lectin_VcfQ VcfQ bacterial pilus biogenesis protein, lectin domain. This family includes bacterial proteins homologous to the VcfQ (also known as MshQ) bacterial pilus biogenesis protein.  VcfQ is encoded by the vcfQ gene of the type IV pilus gene cluster of Vibrio cholerae and is essential for type IV pilus assembly.  VcfQ has a Laminin G-like domain as well as an L-type lectin domain.
Probab=43.37  E-value=1.3e+02  Score=25.00  Aligned_cols=27  Identities=22%  Similarity=0.271  Sum_probs=23.6

Q ss_pred             cCCCcceEeeEeeecccccceeecccc
Q 046926           79 LHLPEFVTFGFSMATGVDFAIFSIYSW  105 (226)
Q Consensus        79 ~~l~~~v~vGFsastg~~~~~~~il~W  105 (226)
                      ..+|+..+.+|+++||...-.|.|-+.
T Consensus       225 ~avP~~f~lS~TgSTGgstN~HEIdnf  251 (255)
T cd06900         225 DAIPENFYLSFTGSTGGSTNTHEIDNF  251 (255)
T ss_pred             CCCCccEEEEEEecCCCcccceeecce
Confidence            678999999999999999989988543


No 90 
>TIGR01478 STEVOR variant surface antigen, stevor family. This model represents the stevor branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of stevor sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 8 bits.
Probab=39.17  E-value=20  Score=30.40  Aligned_cols=15  Identities=20%  Similarity=0.361  Sum_probs=9.4

Q ss_pred             HHHHHhhhheeeccC
Q 046926          150 VLIIRLAGIGRKRKE  164 (226)
Q Consensus       150 ~~~~~~~~~~~r~~~  164 (226)
                      ++++++|+++||++.
T Consensus       275 liiLYiWlyrrRK~s  289 (295)
T TIGR01478       275 LIILYIWLYRRRKKS  289 (295)
T ss_pred             HHHHHHHHHHhhccc
Confidence            444555678887654


No 91 
>PTZ00370 STEVOR; Provisional
Probab=37.72  E-value=21  Score=30.24  Aligned_cols=15  Identities=13%  Similarity=0.308  Sum_probs=9.4

Q ss_pred             HHHHHhhhheeeccC
Q 046926          150 VLIIRLAGIGRKRKE  164 (226)
Q Consensus       150 ~~~~~~~~~~~r~~~  164 (226)
                      ++++++|+++||++.
T Consensus       271 liilYiwlyrrRK~s  285 (296)
T PTZ00370        271 LIILYIWLYRRRKNS  285 (296)
T ss_pred             HHHHHHHHHHhhcch
Confidence            444555678887654


No 92 
>PTZ00267 NIMA-related protein kinase; Provisional
Probab=36.84  E-value=17  Score=32.95  Aligned_cols=19  Identities=5%  Similarity=-0.025  Sum_probs=15.7

Q ss_pred             cCCccccCCCcceEEEEeC
Q 046926          204 DDQKLGQGGFGGVYKGFLR  222 (226)
Q Consensus       204 ~~n~lG~GgfG~VYKG~L~  222 (226)
                      -.++||+|+||.||++.-.
T Consensus        71 ~~~~lg~G~~g~vy~a~~~   89 (478)
T PTZ00267         71 LTTLVGRNPTTAAFVATRG   89 (478)
T ss_pred             EEEEEEeCCCcEEEEEEEc
Confidence            3458999999999998654


No 93 
>PF04689 S1FA:  DNA binding protein S1FA;  InterPro: IPR006779  S1FA is an unusual small plant peptide of only 70 amino acids with a basic domain which contains a nuclear localization signal and a putative DNA binding helix. S1FA is highly conserved between dicotyledonous and monocotyledonous plants and may be a DNA-binding protein that specifically recognises the negative promoter element S1F [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=35.77  E-value=65  Score=20.82  Aligned_cols=22  Identities=27%  Similarity=0.143  Sum_probs=14.3

Q ss_pred             CCCCcccEEeeehhhHHHHHHH
Q 046926          128 RKNRKAPVVGLSLGGGFLVGGV  149 (226)
Q Consensus       128 ~~~~~~~ii~i~v~~~~~~~~~  149 (226)
                      +..+.++|+.++++.+++++++
T Consensus         8 KGlnPGlIVLlvV~g~ll~flv   29 (69)
T PF04689_consen    8 KGLNPGLIVLLVVAGLLLVFLV   29 (69)
T ss_pred             cCCCCCeEEeehHHHHHHHHHH
Confidence            3455677877777766665554


No 94 
>PF14014 DUF4230:  Protein of unknown function (DUF4230)
Probab=35.71  E-value=70  Score=24.05  Aligned_cols=41  Identities=12%  Similarity=0.288  Sum_probs=27.9

Q ss_pred             CeeEEEcCCCCccceEEEEEcCCCcEEEEEEEeCCCCCcccceeEEEeccc
Q 046926           28 SHVGVDINSVQSKKNAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLR   78 (226)
Q Consensus        28 ~hvgi~~n~~~s~~~~~i~y~~~~~~l~v~~~~~~~~~~~~~~l~~~~~Ls   78 (226)
                      -+.|||+..+.   .-+|+.|...+.|.|.|       |..-+++..+|..
T Consensus        48 v~~GiDLs~i~---~~~i~~d~~~~~i~I~L-------P~~~i~~~~id~~   88 (157)
T PF14014_consen   48 VKAGIDLSKIK---EEDIEVDEDGKTITITL-------PPPEILSVEIDED   88 (157)
T ss_pred             EEEEEEhHHCC---cceEEEcCCCCEEEEEC-------CCcEEeeeecCcc
Confidence            46778876555   33488888888999988       3333667777744


No 95 
>PTZ00046 rifin; Provisional
Probab=35.33  E-value=12  Score=32.75  Aligned_cols=22  Identities=27%  Similarity=0.249  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHhhhheeeccCCc
Q 046926          145 LVGGVVLIIRLAGIGRKRKEGD  166 (226)
Q Consensus       145 ~~~~~~~~~~~~~~~~r~~~~~  166 (226)
                      ++++++++++++.++|+++.++
T Consensus       327 IVLIMvIIYLILRYRRKKKMkK  348 (358)
T PTZ00046        327 IVLIMVIIYLILRYRRKKKMKK  348 (358)
T ss_pred             HHHHHHHHHHHHHhhhcchhHH
Confidence            3333444455555888776544


No 96 
>TIGR01477 RIFIN variant surface antigen, rifin family. This model represents the rifin branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of rifin sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 20 bits.
Probab=34.15  E-value=13  Score=32.50  Aligned_cols=21  Identities=29%  Similarity=0.216  Sum_probs=11.7

Q ss_pred             HHHHHHHHHhhhheeeccCCc
Q 046926          146 VGGVVLIIRLAGIGRKRKEGD  166 (226)
Q Consensus       146 ~~~~~~~~~~~~~~~r~~~~~  166 (226)
                      +++++++++++.++|+++.++
T Consensus       323 VLIMvIIYLILRYRRKKKMkK  343 (353)
T TIGR01477       323 VLIMVIIYLILRYRRKKKMKK  343 (353)
T ss_pred             HHHHHHHHHHHHhhhcchhHH
Confidence            333444455555888766543


No 97 
>PF15102 TMEM154:  TMEM154 protein family
Probab=33.83  E-value=66  Score=24.50  Aligned_cols=9  Identities=0%  Similarity=-0.160  Sum_probs=3.8

Q ss_pred             EEeeehhhH
Q 046926          135 VVGLSLGGG  143 (226)
Q Consensus       135 ii~i~v~~~  143 (226)
                      ++.+++..+
T Consensus        58 iLmIlIP~V   66 (146)
T PF15102_consen   58 ILMILIPLV   66 (146)
T ss_pred             EEEEeHHHH
Confidence            444444433


No 98 
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only]
Probab=33.24  E-value=20  Score=33.67  Aligned_cols=19  Identities=47%  Similarity=0.781  Sum_probs=15.8

Q ss_pred             ccccCCCcceEEEEeCCCC
Q 046926          207 KLGQGGFGGVYKGFLRETN  225 (226)
Q Consensus       207 ~lG~GgfG~VYKG~L~~~~  225 (226)
                      +||+|.|=+||||.=...|
T Consensus        47 vLGrGafKtVYka~De~~g   65 (632)
T KOG0584|consen   47 VLGRGAFKTVYKAFDEEEG   65 (632)
T ss_pred             hcccccceeeeeccccccc
Confidence            8999999999999754443


No 99 
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed
Probab=32.73  E-value=38  Score=31.56  Aligned_cols=24  Identities=21%  Similarity=0.315  Sum_probs=20.1

Q ss_pred             CCCcCCccccCCCcceEEEEeCCCC
Q 046926          201 DFNDDQKLGQGGFGGVYKGFLRETN  225 (226)
Q Consensus       201 ~F~~~n~lG~GgfG~VYKG~L~~~~  225 (226)
                      .|++ .-||+|++|.||++++.+.|
T Consensus       121 ~fd~-~PlasaSiaQVh~A~l~~~G  144 (537)
T PRK04750        121 DFDI-KPLASASIAQVHFARLKDNG  144 (537)
T ss_pred             hcCh-hhhcCCCccEEEEEEECCCC
Confidence            4666 67999999999999998744


No 100
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms]
Probab=32.67  E-value=19  Score=34.75  Aligned_cols=17  Identities=41%  Similarity=0.720  Sum_probs=15.4

Q ss_pred             ccccCCCcceEEEEeCC
Q 046926          207 KLGQGGFGGVYKGFLRE  223 (226)
Q Consensus       207 ~lG~GgfG~VYKG~L~~  223 (226)
                      +||+|.||.|.+|.+..
T Consensus       117 ~LG~GsFgvV~rg~Wt~  133 (1039)
T KOG0199|consen  117 LLGEGSFGVVKRGTWTQ  133 (1039)
T ss_pred             HhcCcceeeEeeccccC
Confidence            89999999999998764


No 101
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms]
Probab=31.77  E-value=27  Score=33.00  Aligned_cols=17  Identities=47%  Similarity=0.743  Sum_probs=15.5

Q ss_pred             ccccCCCcceEEEEeCC
Q 046926          207 KLGQGGFGGVYKGFLRE  223 (226)
Q Consensus       207 ~lG~GgfG~VYKG~L~~  223 (226)
                      .||+|.||.|+||.+..
T Consensus       303 ~lg~g~fG~v~~~~~~~  319 (609)
T KOG0200|consen  303 YLGEGAFGQVVKALLFG  319 (609)
T ss_pred             eeecccccceEeEEEee
Confidence            89999999999998854


No 102
>TIGR01624 LRP1_Cterm LRP1 C-terminal domain. This model represents a tightly conserved small domain found in LRP1 and related plant proteins. This family also contains a well-conserved putative zinc finger domain (TIGR01623). The rest of the sequence of most members consists of highly divergent, low-complexity sequence.
Probab=31.58  E-value=36  Score=20.67  Aligned_cols=12  Identities=50%  Similarity=1.060  Sum_probs=10.8

Q ss_pred             cceEEEEeCCCC
Q 046926          214 GGVYKGFLRETN  225 (226)
Q Consensus       214 G~VYKG~L~~~~  225 (226)
                      |-|+||.|-++|
T Consensus        38 GHvFkGiLyDqG   49 (50)
T TIGR01624        38 GHVFKGFLHDQG   49 (50)
T ss_pred             ceEEeeEEeccC
Confidence            889999998876


No 103
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=30.84  E-value=16  Score=33.02  Aligned_cols=8  Identities=25%  Similarity=0.430  Sum_probs=0.0

Q ss_pred             cEEeeehh
Q 046926          134 PVVGLSLG  141 (226)
Q Consensus       134 ~ii~i~v~  141 (226)
                      .+++++++
T Consensus       357 vVlgvavl  364 (439)
T PF02480_consen  357 VVLGVAVL  364 (439)
T ss_dssp             --------
T ss_pred             HHHHHHHH
Confidence            33343333


No 104
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=30.66  E-value=23  Score=34.28  Aligned_cols=18  Identities=39%  Similarity=0.728  Sum_probs=14.8

Q ss_pred             CcCCccccCCCcceEEEE
Q 046926          203 NDDQKLGQGGFGGVYKGF  220 (226)
Q Consensus       203 ~~~n~lG~GgfG~VYKG~  220 (226)
                      .+.-+||+|.||+||-|.
T Consensus       578 ~ervVLGKGTYG~VYA~R  595 (1226)
T KOG4279|consen  578 NERVVLGKGTYGTVYAAR  595 (1226)
T ss_pred             CceEEeecCceeEEEeec
Confidence            345579999999999885


No 105
>PF03229 Alpha_GJ:  Alphavirus glycoprotein J;  InterPro: IPR004913 The exact function of the herpesvirus glycoprotein J is unknown, but it appears to play a role in the inhibition of apotosis of the host cell [].; GO: 0019050 suppression by virus of host apoptosis
Probab=29.23  E-value=43  Score=24.36  Aligned_cols=16  Identities=19%  Similarity=0.117  Sum_probs=8.8

Q ss_pred             cEEeeehhhHHHHHHH
Q 046926          134 PVVGLSLGGGFLVGGV  149 (226)
Q Consensus       134 ~ii~i~v~~~~~~~~~  149 (226)
                      .++.+++|+++.+.+.
T Consensus        84 ~aLp~VIGGLcaL~La   99 (126)
T PF03229_consen   84 FALPLVIGGLCALTLA   99 (126)
T ss_pred             cchhhhhhHHHHHHHH
Confidence            4556666666544443


No 106
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms]
Probab=29.11  E-value=45  Score=29.25  Aligned_cols=24  Identities=21%  Similarity=0.486  Sum_probs=19.0

Q ss_pred             chHHHHHHHhCCCcCCccccCCCcceEEE
Q 046926          191 PYKELALATNDFNDDQKLGQGGFGGVYKG  219 (226)
Q Consensus       191 ~~~el~~AT~~F~~~n~lG~GgfG~VYKG  219 (226)
                      +++|+.+-|..     +||+|+|+.|--.
T Consensus        74 ~F~d~YkLt~e-----~LGeGAyasVqtc   97 (463)
T KOG0607|consen   74 KFEDMYKLTSE-----LLGEGAYASVQTC   97 (463)
T ss_pred             hHHHHHHhHHH-----HhcCccceeeeee
Confidence            46788888865     9999999998544


No 107
>PLN03150 hypothetical protein; Provisional
Probab=28.64  E-value=88  Score=29.66  Aligned_cols=14  Identities=14%  Similarity=0.373  Sum_probs=7.2

Q ss_pred             cccEEeeehhhHHH
Q 046926          132 KAPVVGLSLGGGFL  145 (226)
Q Consensus       132 ~~~ii~i~v~~~~~  145 (226)
                      ...+++++++++++
T Consensus       543 ~~~~i~~~~~~~~~  556 (623)
T PLN03150        543 VGAKIGIAFGVSVA  556 (623)
T ss_pred             CceEEEEEhHHHHH
Confidence            34455555555543


No 108
>COG4282 SMI1 Protein involved in beta-1,3-glucan synthesis [Carbohydrate transport and metabolism]
Probab=28.59  E-value=79  Score=24.73  Aligned_cols=29  Identities=21%  Similarity=0.433  Sum_probs=19.6

Q ss_pred             CCCCCeeEEEcCCCCccc---eEEEEEcCCCc
Q 046926           24 DPTFSHVGVDINSVQSKK---NAWISYNSSTH   52 (226)
Q Consensus        24 d~~~~hvgi~~n~~~s~~---~~~i~y~~~~~   52 (226)
                      |+-+||++||+-.-....   -.|.-||-.++
T Consensus       126 d~~Gnhi~IDLaPgp~g~ygQiI~FgrD~dtk  157 (191)
T COG4282         126 DPRGNHICIDLAPGPTGGYGQIIWFGRDEDTK  157 (191)
T ss_pred             cCCCCeEEEecCCCCCCCcceEEEeccccccC
Confidence            788999999985443322   46666776554


No 109
>PHA03291 envelope glycoprotein I; Provisional
Probab=27.89  E-value=35  Score=29.80  Aligned_cols=18  Identities=6%  Similarity=0.385  Sum_probs=14.4

Q ss_pred             eEEEEEcCCCcEEEEEEE
Q 046926           42 NAWISYNSSTHNLSVAFT   59 (226)
Q Consensus        42 ~~~i~y~~~~~~l~v~~~   59 (226)
                      .|||++.......-+.+.
T Consensus       147 RV~vdgat~adlF~lg~~  164 (401)
T PHA03291        147 RVWVEGATNASLFPLGLA  164 (401)
T ss_pred             EEEeCCCcccceEEEeee
Confidence            899999888777766666


No 110
>PF05808 Podoplanin:  Podoplanin;  InterPro: IPR008783 This family consists of several mammalian podoplanin-like proteins which are thought to control specifically the unique shape of podocytes [].; GO: 0016021 integral to membrane; PDB: 3IET_X.
Probab=27.75  E-value=20  Score=27.71  Aligned_cols=24  Identities=17%  Similarity=0.238  Sum_probs=0.0

Q ss_pred             CCCCCcccEEeeehhhHHHHHHHH
Q 046926          127 RRKNRKAPVVGLSLGGGFLVGGVV  150 (226)
Q Consensus       127 ~~~~~~~~ii~i~v~~~~~~~~~~  150 (226)
                      +.......+++|++|+++.+.++.
T Consensus       123 k~GL~T~tLVGIIVGVLlaIG~ig  146 (162)
T PF05808_consen  123 KDGLSTVTLVGIIVGVLLAIGFIG  146 (162)
T ss_dssp             ------------------------
T ss_pred             cCCcceeeeeeehhhHHHHHHHHh
Confidence            334455567777777666555443


No 111
>KOG3482 consensus Small nuclear ribonucleoprotein (snRNP) SMF [RNA processing and modification]
Probab=27.50  E-value=40  Score=22.29  Aligned_cols=19  Identities=32%  Similarity=0.356  Sum_probs=13.5

Q ss_pred             CCccccCCCcceEEEEeCC
Q 046926          205 DQKLGQGGFGGVYKGFLRE  223 (226)
Q Consensus       205 ~n~lG~GgfG~VYKG~L~~  223 (226)
                      ..++=+=.+|..|||+|-.
T Consensus        19 k~V~vkLKwg~eYkG~Lvs   37 (79)
T KOG3482|consen   19 KPVLVKLKWGQEYKGTLVS   37 (79)
T ss_pred             CeEEEEEecCcEEEEEEEE
Confidence            3455556789999999843


No 112
>PF14914 LRRC37AB_C:  LRRC37A/B like protein 1 C-terminal domain
Probab=27.41  E-value=35  Score=25.96  Aligned_cols=14  Identities=7%  Similarity=0.188  Sum_probs=7.0

Q ss_pred             ccEEeeehhhHHHH
Q 046926          133 APVVGLSLGGGFLV  146 (226)
Q Consensus       133 ~~ii~i~v~~~~~~  146 (226)
                      .+++++.+.+++.+
T Consensus       120 klilaisvtvv~~i  133 (154)
T PF14914_consen  120 KLILAISVTVVVMI  133 (154)
T ss_pred             hhHHHHHHHHHHHH
Confidence            45555555544433


No 113
>PF10049 DUF2283:  Protein of unknown function (DUF2283);  InterPro: IPR019270  Members of this family of hypothetical proteins have no known function. 
Probab=26.61  E-value=82  Score=19.02  Aligned_cols=15  Identities=20%  Similarity=0.415  Sum_probs=14.2

Q ss_pred             EEEEcCCCcEEEEEE
Q 046926           44 WISYNSSTHNLSVAF   58 (226)
Q Consensus        44 ~i~y~~~~~~l~v~~   58 (226)
                      ||+||..+..|-+++
T Consensus         2 ki~YD~~~D~lyi~l   16 (50)
T PF10049_consen    2 KIEYDPEADALYIRL   16 (50)
T ss_pred             EeEEcCcCCEEEEEE
Confidence            899999999999999


No 114
>PF04971 Lysis_S:  Lysis protein S ;  InterPro: IPR007054 The lysis S protein is a cytotoxic protein forming holes in membranes causing cell lysis. The action of Lysis S is independent of the proportion of acidic phospholipids in the membrane [].
Probab=26.56  E-value=25  Score=23.08  Aligned_cols=9  Identities=22%  Similarity=0.290  Sum_probs=3.8

Q ss_pred             cEEeeehhh
Q 046926          134 PVVGLSLGG  142 (226)
Q Consensus       134 ~ii~i~v~~  142 (226)
                      ..|+++.++
T Consensus        34 ~aIGvi~gi   42 (68)
T PF04971_consen   34 AAIGVIGGI   42 (68)
T ss_pred             hhHHHHHHH
Confidence            344444333


No 115
>PF07472 PA-IIL:  Fucose-binding lectin II (PA-IIL);  InterPro: IPR010907 This entry represents calcium-mediated lectins. Structures have been determined for both fucose-binding lectin II (PA-IIL) [] and mannose-specific lectin II (RS-IIL) []. These proteins have homologous structures, their monomers consisting of a 9-stranded beta sandwich with Greek-key topology. Each monomer contains two calcium ions that mediate an exceptionally high binding affinity to the monosaccharide ligand in a recognition mode unique among carbohydrate-protein interactions. In Pseudomonas aeruginosa, PA-IIL contributes to the pathogenic virulence of the bacterium, functioning as a tetramer when binding fucose []. In the plant pathogen Ralstonia solanacearum (Pseudomonas solanacearum), RS-IIL recognises fucose, but displays much higher affinity to mannose and fructose, which is opposite to the preference of PA-IIL. ; PDB: 2WRA_A 2WR9_C 1OUX_C 2VUC_B 1GZT_C 2BOJ_D 2JDM_D 2JDH_D 1W8F_D 1UZV_A ....
Probab=25.73  E-value=2.6e+02  Score=20.12  Aligned_cols=54  Identities=19%  Similarity=0.158  Sum_probs=32.2

Q ss_pred             EEcCCCcEEEEEEEeCCCCCcccceeEEEeccccCCCcceEeeEeee-ccccccee---eccccc
Q 046926           46 SYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMA-TGVDFAIF---SIYSWE  106 (226)
Q Consensus        46 ~y~~~~~~l~v~~~~~~~~~~~~~~l~~~~~Ls~~l~~~v~vGFsas-tg~~~~~~---~il~W~  106 (226)
                      .|++....+.|.+...+  || .++.+...+|..    .++.|.-++ .|.-...+   -+|.|.
T Consensus        49 ~l~Sg~Gkv~i~v~~ng--k~-s~l~~~q~~l~~----~~~~~ivgsEdGtD~DYND~ivvLnWp  106 (107)
T PF07472_consen   49 VLNSGSGKVRIEVTANG--KP-SKLRSSQNTLDG----KPYFGIVGSEDGTDNDYNDSIVVLNWP  106 (107)
T ss_dssp             EEE-TTSEEEEEEEETT--EE--EEEEEEEEETT----TEEEEEEEEESSSSSSSBSEEEEEEES
T ss_pred             EEecCCCeEEEEEEeCC--cc-ccceeeeeeccC----ceeEEEEEcccCCCCCcccEEEEEecc
Confidence            38888888888887766  43 346777777665    677775444 44322222   345664


No 116
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms]
Probab=22.95  E-value=46  Score=31.93  Aligned_cols=21  Identities=38%  Similarity=0.803  Sum_probs=17.6

Q ss_pred             CCcCCccccCCCcceEEEEeC
Q 046926          202 FNDDQKLGQGGFGGVYKGFLR  222 (226)
Q Consensus       202 F~~~n~lG~GgfG~VYKG~L~  222 (226)
                      ..-.++||-|-||.||-|++.
T Consensus       269 ItMkhKLGGGQYGeVYeGvWK  289 (1157)
T KOG4278|consen  269 ITMKHKLGGGQYGEVYEGVWK  289 (1157)
T ss_pred             eeeeeccCCCcccceeeeeee
Confidence            344679999999999999875


No 117
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms]
Probab=22.90  E-value=46  Score=32.21  Aligned_cols=20  Identities=30%  Similarity=0.493  Sum_probs=16.9

Q ss_pred             CCccccCCCcceEEEEeCCC
Q 046926          205 DQKLGQGGFGGVYKGFLRET  224 (226)
Q Consensus       205 ~n~lG~GgfG~VYKG~L~~~  224 (226)
                      ++.|-+|||+.||-+.....
T Consensus        42 ~~vLAEGGFa~VYla~~~~~   61 (738)
T KOG1989|consen   42 EKVLAEGGFAQVYLAQDVKG   61 (738)
T ss_pred             EEEEccCCcEEEEEEEecCC
Confidence            45899999999999987654


No 118
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms]
Probab=22.45  E-value=44  Score=34.52  Aligned_cols=28  Identities=29%  Similarity=0.470  Sum_probs=22.1

Q ss_pred             HHhCCCcCCccccCCCcceEEEEeCCCC
Q 046926          198 ATNDFNDDQKLGQGGFGGVYKGFLRETN  225 (226)
Q Consensus       198 AT~~F~~~n~lG~GgfG~VYKG~L~~~~  225 (226)
                      .|-.+...+.||.|-||.||-++=.+.|
T Consensus      1233 V~~rWqrg~~Ig~G~fG~VYtavN~~tG 1260 (1509)
T KOG4645|consen 1233 VTFRWQRGNFIGGGTFGKVYTAVNLDTG 1260 (1509)
T ss_pred             ceeeeccccccCCcceeeeEEeecCCcc
Confidence            3445677899999999999998766554


No 119
>PTZ00208 65 kDa invariant surface glycoprotein; Provisional
Probab=21.43  E-value=24  Score=31.34  Aligned_cols=7  Identities=43%  Similarity=0.734  Sum_probs=3.2

Q ss_pred             CCCcceE
Q 046926          211 GGFGGVY  217 (226)
Q Consensus       211 GgfG~VY  217 (226)
                      ||-..||
T Consensus       427 g~~s~~~  433 (436)
T PTZ00208        427 GGVSSVK  433 (436)
T ss_pred             CCCCcee
Confidence            4444444


No 120
>COG4540 gpV Phage P2 baseplate assembly protein gpV [General function prediction only]
Probab=21.05  E-value=62  Score=25.32  Aligned_cols=18  Identities=28%  Similarity=0.381  Sum_probs=16.1

Q ss_pred             eEEEEEcCCCcEEEEEEE
Q 046926           42 NAWISYNSSTHNLSVAFT   59 (226)
Q Consensus        42 ~~~i~y~~~~~~l~v~~~   59 (226)
                      -+|++||...++|.|...
T Consensus        95 Ga~~~YD~Aah~ltV~g~  112 (184)
T COG4540          95 GAAFEYDRAAHRLTVNGG  112 (184)
T ss_pred             CccEEeehhcceEEEecC
Confidence            699999999999999764


No 121
>PF11225 DUF3024:  Protein of unknown function (DUF3024);  InterPro: IPR021388 This entry is represented by Bacteriophage 933W, L0084. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=20.42  E-value=86  Score=19.57  Aligned_cols=21  Identities=10%  Similarity=0.166  Sum_probs=18.1

Q ss_pred             eEEEEEcCCCcEEEEEEEeCC
Q 046926           42 NAWISYNSSTHNLSVAFTGFR   62 (226)
Q Consensus        42 ~~~i~y~~~~~~l~v~~~~~~   62 (226)
                      -|+|.|+..++...++....+
T Consensus         6 iAk~~~~~~~~~W~lyw~~~~   26 (57)
T PF11225_consen    6 IAKLTFDKTTGCWKLYWMDHD   26 (57)
T ss_pred             eEEEEEeCCCCEEEEEEECCC
Confidence            589999999999999986554


Done!