Query         046989
Match_columns 146
No_of_seqs    13 out of 15
Neff          2.2 
Searched_HMMs 46136
Date          Fri Mar 29 06:30:20 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/046989.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/046989hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10414 CysG_dimeriser:  Siroh  70.4     3.1 6.7E-05   26.9   1.6   19   23-41     25-45  (60)
  2 PF14169 YdjO:  Cold-inducible   61.3     4.1 8.8E-05   28.3   0.9   15   48-62     26-40  (59)
  3 PF13911 AhpC-TSA_2:  AhpC/TSA   49.0      13 0.00027   25.8   1.7   27  102-128    34-60  (115)
  4 PF13311 DUF4080:  Protein of u  33.9      39 0.00085   26.5   2.5   25   59-84     18-42  (190)
  5 KOG0013 Uncharacterized conser  33.7      22 0.00049   30.5   1.2   17   18-34     41-57  (231)
  6 PF00319 SRF-TF:  SRF-type tran  33.5      44 0.00096   22.0   2.4   25   18-42     10-34  (51)
  7 PF14403 CP_ATPgrasp_2:  Circul  33.1      33 0.00071   31.3   2.3   48   95-144   379-426 (445)
  8 COG0693 ThiJ Putative intracel  33.0      30 0.00064   25.7   1.7   41    2-42     69-109 (188)
  9 cd02621 Peptidase_C1A_Cathepsi  27.6      26 0.00055   27.6   0.6   14   43-56    213-226 (243)
 10 PF14198 TnpV:  Transposon-enco  26.1     9.6 0.00021   28.4  -1.9   36   47-82     24-59  (111)
 11 PF10123 Mu-like_Pro:  Mu-like   25.6   1E+02  0.0022   25.9   3.8   54   68-124   266-321 (326)
 12 cd03368 Ribosomal_S12 S12-like  25.4      32 0.00069   26.5   0.7   13    1-13     61-73  (108)
 13 cd02620 Peptidase_C1A_Cathepsi  24.6      32 0.00069   27.2   0.6   12   43-54    209-220 (236)
 14 CHL00051 rps12 ribosomal prote  23.9      34 0.00075   26.9   0.7   11    1-11     63-73  (123)
 15 PF07120 DUF1376:  Protein of u  23.5      51  0.0011   22.9   1.4   30   19-48     47-79  (88)
 16 PF12845 TBD:  TBD domain;  Int  22.7      28 0.00061   23.9   0.0   10   76-85      7-16  (57)
 17 TIGR00981 rpsL_bact ribosomal   21.9      40 0.00087   26.5   0.7   14    1-14     63-76  (124)
 18 PF11943 DUF3460:  Protein of u  21.8      48   0.001   23.2   1.0   23   16-38     20-42  (60)
 19 cd00319 Ribosomal_S12_like Rib  21.6      41 0.00089   25.3   0.7   13    1-13     48-60  (95)
 20 PF14122 YokU:  YokU-like prote  21.2      19  0.0004   27.0  -1.2   15   74-88     10-24  (87)
 21 PF06983 3-dmu-9_3-mt:  3-demet  20.6      48   0.001   24.0   0.8   26   26-58     86-111 (116)
 22 COG2764 PhnB Uncharacterized p  20.4      82  0.0018   24.3   2.1   49    7-59     74-125 (136)
 23 cd07261 Glo_EDI_BRP_like_11 Th  20.1   1E+02  0.0023   20.0   2.3   52    6-59     58-109 (114)
 24 COG4110 Uncharacterized protei  20.1      65  0.0014   27.2   1.6   31  108-144    59-89  (200)

No 1  
>PF10414 CysG_dimeriser:  Sirohaem synthase dimerisation region;  InterPro: IPR019478  Bacterial sulphur metabolism depends on the iron-containing porphinoid sirohaem. CysG is a multi-functional enzyme with S-adenosyl-L-methionine (SAM)-dependent bismethyltransferase, dehydrogenase and ferrochelatase activities. CysG synthesizes sirohaem from uroporphyrinogen III via reactions which encompass two branchpoint intermediates in tetrapyrrole biosynthesis, diverting flux first from protoporphyrin IX biosynthesis and then from cobalamin (vitamin B12) biosynthesis. CysG is a dimer. Its dimerisation region is 74 residues long, and acts to hold the two structurally similar protomers held together asymmetrically through a number of salt-bridges across complementary residues within the dimerisation region []. CysG dimerisation produces a series of active sites, accounting for CysG's multi-functionality, catalysing four diverse reactions:   Two SAM-dependent methylations NAD+-dependent tetrapyrrole dehydrogenation Metal chelation  ; GO: 0006779 porphyrin-containing compound biosynthetic process, 0055114 oxidation-reduction process; PDB: 1PJT_A 1PJS_A 1PJQ_A.
Probab=70.40  E-value=3.1  Score=26.94  Aligned_cols=19  Identities=37%  Similarity=0.733  Sum_probs=12.9

Q ss_pred             HHHHHHHHHhhc--hhhhccC
Q 046989           23 AKRKKFWEKAVD--IEERCGV   41 (146)
Q Consensus        23 ~~Rkk~WEkAvd--i~elCg~   41 (146)
                      .+|+.|||+.+|  +.+++-.
T Consensus        25 ~~RR~FWe~~~~g~~~~~~~~   45 (60)
T PF10414_consen   25 AERRRFWERFFDGPFAELVLA   45 (60)
T ss_dssp             HHHHHHHHHHT-HHHHHHHHT
T ss_pred             hHHHHHHHHHHcCHHHHHHHC
Confidence            478999999994  4444433


No 2  
>PF14169 YdjO:  Cold-inducible protein YdjO
Probab=61.32  E-value=4.1  Score=28.28  Aligned_cols=15  Identities=33%  Similarity=0.585  Sum_probs=11.3

Q ss_pred             cceeeccCCCCCCCc
Q 046989           48 VKEEMRGNFNHSNKP   62 (146)
Q Consensus        48 vrG~mRDnFnhsn~~   62 (146)
                      -.|+|||||--...|
T Consensus        26 C~gWmR~nFs~~~~p   40 (59)
T PF14169_consen   26 CNGWMRDNFSFEEEP   40 (59)
T ss_pred             CCcccccccccCCCc
Confidence            589999999755443


No 3  
>PF13911 AhpC-TSA_2:  AhpC/TSA antioxidant enzyme
Probab=49.01  E-value=13  Score=25.75  Aligned_cols=27  Identities=22%  Similarity=0.198  Sum_probs=21.3

Q ss_pred             CCCCCCcccccchhhHHHhhccccccc
Q 046989          102 ARVCSPILEDGRNGLFQRLRLARLETS  128 (146)
Q Consensus       102 ARt~~Pi~~dg~~~lF~~lGL~~l~~~  128 (146)
                      ..-+-||+-|.+..||+.|||.+.-.+
T Consensus        34 ~~~p~~ly~D~~~~lY~~lg~~~~~~~   60 (115)
T PF13911_consen   34 TGFPFPLYVDPERKLYKALGLKRGLKW   60 (115)
T ss_pred             cCCCCcEEEeCcHHHHHHhCCcccccc
Confidence            344567889999999999999984443


No 4  
>PF13311 DUF4080:  Protein of unknown function (DUF4080)
Probab=33.86  E-value=39  Score=26.53  Aligned_cols=25  Identities=28%  Similarity=0.426  Sum_probs=20.2

Q ss_pred             CCCccchHhhhhhhhHHHHHHHHhhc
Q 046989           59 SNKPISYAEHFRNSQFVESILDVYRE   84 (146)
Q Consensus        59 sn~~Is~~~Hf~N~r~veSiLd~YWE   84 (146)
                      +|.-|||.| ++--+-||.|||.||.
T Consensus        18 ~t~~Ls~~e-i~~Lk~~e~~le~yyN   42 (190)
T PF13311_consen   18 STKWLSFDE-IQRLKRFEDMLEKYYN   42 (190)
T ss_pred             eCCCCCHHH-HHHHHHHHHHHHHHhh
Confidence            567789887 5567779999999996


No 5  
>KOG0013 consensus Uncharacterized conserved protein [Function unknown]
Probab=33.69  E-value=22  Score=30.55  Aligned_cols=17  Identities=35%  Similarity=0.896  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHHHHHhhc
Q 046989           18 EARIRAKRKKFWEKAVD   34 (146)
Q Consensus        18 EAr~R~~Rkk~WEkAvd   34 (146)
                      +-.+|+||..|||-|--
T Consensus        41 ~gqlrskRdEFWdTapA   57 (231)
T KOG0013|consen   41 KGQLRSKRDEFWDTAPA   57 (231)
T ss_pred             hhhhhhhhhhhhhcccc
Confidence            56799999999998754


No 6  
>PF00319 SRF-TF:  SRF-type transcription factor (DNA-binding and dimerisation domain);  InterPro: IPR002100 Human serum response factor (SRF) is a ubiquitous nuclear protein important for cell proliferation and differentiation. SRF function is essential for transcriptional regulation of numerous growth-factor-inducible genes, such as c-fos oncogene and muscle-specific actin genes. A core domain of around 90 amino acids is sufficient for the activities of DNA-binding, dimerisation and interaction with accessory factors. Within the core is a DNA-binding region, designated the MADS box [], that is highly similar to many eukaryotic regulatory proteins: among these are MCM1, the regulator of cell type-specific genes in fission yeast; DSRF, a Drosophila trachea development factor; the MEF2 family of myocyte-specific enhancer factors; and the Agamous and Deficiens families of plant homeotic proteins. In SRF, the MADS box has been shown to be involved in DNA-binding and dimerisation []. Proteins belonging to the MADS family function as dimers, the primary DNA-binding element of which is an anti-parallel coiled coil of two amphipathic alpha-helices, one from each subunit. The DNA wraps around the coiled coil allowing the basic N-termini of the helices to fit into the DNA major groove. The chain extending from the helix N-termini reaches over the DNA backbone and penetrates into the minor groove. A 4-stranded, anti-parallel beta-sheet packs against the coiled-coil face opposite the DNA and is the central element of the dimerisation interface. The MADS-box domain is commonly found associated with K-box region see IPR002487 from INTERPRO ; GO: 0003677 DNA binding, 0046983 protein dimerization activity; PDB: 1MNM_B 1N6J_A 1TQE_S 3MU6_D 3P57_I 1EGW_A 1C7U_B 3KOV_A 1HBX_A 1K6O_C ....
Probab=33.52  E-value=44  Score=22.02  Aligned_cols=25  Identities=24%  Similarity=0.606  Sum_probs=18.9

Q ss_pred             HHHHHHHHHHHHHHhhchhhhccCC
Q 046989           18 EARIRAKRKKFWEKAVDIEERCGVG   42 (146)
Q Consensus        18 EAr~R~~Rkk~WEkAvdi~elCg~~   42 (146)
                      .+--+.+|+....||-+++-||+..
T Consensus        10 ~~tf~KRk~gL~KKa~ELs~LC~~~   34 (51)
T PF00319_consen   10 KVTFSKRKKGLFKKASELSTLCGVD   34 (51)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHT-E
T ss_pred             HhHHHHHHhhhhhccceeeeecCCe
Confidence            3344566778899999999999864


No 7  
>PF14403 CP_ATPgrasp_2:  Circularly permuted ATP-grasp type 2 
Probab=33.11  E-value=33  Score=31.30  Aligned_cols=48  Identities=21%  Similarity=0.292  Sum_probs=37.7

Q ss_pred             cccccCCCCCCCCcccccchhhHHHhhccccccccccceeeEEEEEeccC
Q 046989           95 HQTRFDPARVCSPILEDGRNGLFQRLRLARLETSVFNGYTQMVYLQISEQ  144 (146)
Q Consensus        95 ~QtryDPARt~~Pi~~dg~~~lF~~lGL~~l~~~vFn~YtQM~Y~~i~~~  144 (146)
                      -|.++.|.|+.-|.+.||+.. |..... .+.+.+||+=.+=+|.||+..
T Consensus       379 lQe~v~~~~~~~~~~~dg~~~-~~~~~~-~~g~fly~~~~~G~~tR~g~~  426 (445)
T PF14403_consen  379 LQEYVRPPREPMPAFEDGEVV-FEEYPY-DSGPFLYGGKFAGCYTRLGTG  426 (445)
T ss_pred             EEEEecCCccccccccCCcee-Eeeeee-eccceeECCEEEEEEEEeccC
Confidence            699999999999999888853 333332 344599999999999999754


No 8  
>COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only]
Probab=33.04  E-value=30  Score=25.65  Aligned_cols=41  Identities=15%  Similarity=0.203  Sum_probs=34.0

Q ss_pred             ceeeCCCCCcCCCCcHHHHHHHHHHHHHHHhhchhhhccCC
Q 046989            2 IHFYPSGGHSCLRDSDEARIRAKRKKFWEKAVDIEERCGVG   42 (146)
Q Consensus         2 ~~~~~GGGHsC~~~S~EAr~R~~Rkk~WEkAvdi~elCg~~   42 (146)
                      +-+||||-|.+-..-....+...-|+|.++.--|.-+|...
T Consensus        69 al~ipGG~~~~~~~~~~~~~~~~v~~~~~~~k~vaaIC~g~  109 (188)
T COG0693          69 ALVIPGGDHGPEYLRPDPDLLAFVRDFYANGKPVAAICHGP  109 (188)
T ss_pred             EEEECCCccchhhccCcHHHHHHHHHHHHcCCEEEEEChhH
Confidence            34789998999888776777788889999999999999764


No 9  
>cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access. Each subunit of the tetramer is composed of three peptides: the heavy and light chains, which together adopts the papain fold and forms the catalytic domain; and the residual propeptide region, which forms a beta barrel and points towards the substrate's N-terminus. The subunit composition is the result of the unique characteristic of procathepsin C maturation involving the cleavage of the catalytic domain and the non-autocatalytic excision of an activation peptide within its propeptide region. By removing N-terminal dipeptide extensions, cathepsin C activates granule serine peptidases (granzymes) involved in cell-mediated apoptosis, inflammation and tissue remodelling. Loss-of-function mutations in cathepsin C are assoc
Probab=27.55  E-value=26  Score=27.57  Aligned_cols=14  Identities=21%  Similarity=0.397  Sum_probs=10.3

Q ss_pred             CcccccceeeccCC
Q 046989           43 ETGWGVKEEMRGNF   56 (146)
Q Consensus        43 ~~WWGvrG~mRDnF   56 (146)
                      |+.||-+|+||=-.
T Consensus       213 G~~WGe~Gy~~i~~  226 (243)
T cd02621         213 GSSWGEKGYFKIRR  226 (243)
T ss_pred             CCCCCcCCeEEEec
Confidence            35699999997543


No 10 
>PF14198 TnpV:  Transposon-encoded protein TnpV
Probab=26.10  E-value=9.6  Score=28.37  Aligned_cols=36  Identities=22%  Similarity=0.411  Sum_probs=32.4

Q ss_pred             ccceeeccCCCCCCCccchHhhhhhhhHHHHHHHHh
Q 046989           47 GVKEEMRGNFNHSNKPISYAEHFRNSQFVESILDVY   82 (146)
Q Consensus        47 GvrG~mRDnFnhsn~~Is~~~Hf~N~r~veSiLd~Y   82 (146)
                      |.-|.||.+|=+.|+|+-|..-+-++++.+-+.++-
T Consensus        24 GkyG~~~~~yLke~~p~~Y~~ll~~g~L~~~l~eid   59 (111)
T PF14198_consen   24 GKYGRMRKRYLKEHKPILYNNLLLSGKLNEHLAEID   59 (111)
T ss_pred             cHHHHHHHHHHHHhHHHHHHHHHHcchHHHHHHHHH
Confidence            788999999999999999999999999988777654


No 11 
>PF10123 Mu-like_Pro:  Mu-like prophage I protein;  InterPro: IPR012106 This entry is represented by the Bacteriophage Mu, Gp32. The characteristics of the protein distribution suggest prophage matches.
Probab=25.64  E-value=1e+02  Score=25.91  Aligned_cols=54  Identities=15%  Similarity=0.183  Sum_probs=40.7

Q ss_pred             hhhhhhHHHHHHHHhhcCCCCCCCCCccccccCCCC--CCCCcccccchhhHHHhhccc
Q 046989           68 HFRNSQFVESILDVYRELPPVSGPSLTHQTRFDPAR--VCSPILEDGRNGLFQRLRLAR  124 (146)
Q Consensus        68 Hf~N~r~veSiLd~YWElPPvA~PsLT~QtryDPAR--t~~Pi~~dg~~~lF~~lGL~~  124 (146)
                      +-+|..-++.+|+.   +||++.++.+.-+.-.|.-  ...+-|.+.+..+.+.||++.
T Consensus       266 ~~~d~~a~~~~l~~---~p~iaa~~~~~~~~~~~~~~~~~~~~Lt~ee~av~~~lGis~  321 (326)
T PF10123_consen  266 AKQDPAAFKAFLAA---APPIAALSGLQTGGAKPPGPADGSAALTAEELAVCRQLGISP  321 (326)
T ss_pred             HhcCHHHHHHHHHh---CCccccCccccccccCCCCCCCCCCCCCHHHHHHHHHcCCCH
Confidence            45677888999986   8999988877664554443  344458899999999999963


No 12 
>cd03368 Ribosomal_S12 S12-like family, 30S ribosomal protein S12 subfamily; S12 is located at the interface of the large and small ribosomal subunits of prokaryotes, chloroplasts and mitochondria, where it plays an important role in both tRNA and ribosomal subunit interactions. S12 is essential for maintenance of a pretranslocation state and, together with S13, functions as a control element for the rRNA- and tRNA-driven movements of translocation. Antibiotics such as streptomycin bind S12 and cause the ribosome to misread the genetic code.
Probab=25.38  E-value=32  Score=26.51  Aligned_cols=13  Identities=23%  Similarity=0.575  Sum_probs=10.5

Q ss_pred             CceeeCCCCCcCC
Q 046989            1 LIHFYPSGGHSCL   13 (146)
Q Consensus         1 ~~~~~~GGGHsC~   13 (146)
                      +++||||-||+=.
T Consensus        61 v~AyIPG~Ghnlq   73 (108)
T cd03368          61 VTAYIPGEGHNLQ   73 (108)
T ss_pred             EEEEcCCCCCCcc
Confidence            3699999999754


No 13 
>cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag). Cathepsin B is a lysosomal papain-like cysteine peptidase which is expressed in all tissues and functions primarily as an exopeptidase through its carboxydipeptidyl activity. Together with other cathepsins, it is involved in the degradation of proteins, proenzyme activation, Ag processing, metabolism and apoptosis. Cathepsin B has been implicated in a number of human diseases such as cancer, rheumatoid arthritis, osteoporosis and Alzheimer's disease. The unique carboxydipeptidyl activity of cathepsin B is attributed to the presence of an occluding loop in its active site which favors the binding of the C-termini of substrate proteins. Some members of this group do not possess the occluding loop. TIN-Ag is an extracellular matrix basement protein which was originally identified as a target Ag involved in anti-tubular basement membrane
Probab=24.60  E-value=32  Score=27.16  Aligned_cols=12  Identities=33%  Similarity=0.551  Sum_probs=9.4

Q ss_pred             Ccccccceeecc
Q 046989           43 ETGWGVKEEMRG   54 (146)
Q Consensus        43 ~~WWGvrG~mRD   54 (146)
                      |+.||-.|+||=
T Consensus       209 G~~WGe~Gy~ri  220 (236)
T cd02620         209 GTDWGENGYFRI  220 (236)
T ss_pred             CCCCCCCcEEEE
Confidence            456999999863


No 14 
>CHL00051 rps12 ribosomal protein S12
Probab=23.90  E-value=34  Score=26.86  Aligned_cols=11  Identities=27%  Similarity=0.691  Sum_probs=9.4

Q ss_pred             CceeeCCCCCc
Q 046989            1 LIHFYPSGGHS   11 (146)
Q Consensus         1 ~~~~~~GGGHs   11 (146)
                      +++||||-||+
T Consensus        63 v~AyIPGeGhn   73 (123)
T CHL00051         63 ITAYIPGIGHN   73 (123)
T ss_pred             EEEEcCCCCcc
Confidence            47999999994


No 15 
>PF07120 DUF1376:  Protein of unknown function (DUF1376);  InterPro: IPR010781 This entry is represented by Bacteriophage PBC5 (Sinorhizobium phage PBC5), Orf49. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several hypothetical bacterial proteins of around 95 residues in length. The function of this family is unknown.
Probab=23.52  E-value=51  Score=22.90  Aligned_cols=30  Identities=33%  Similarity=0.377  Sum_probs=21.9

Q ss_pred             HHHHHHHHHHHHHhhch--hhh-ccCCCccccc
Q 046989           19 ARIRAKRKKFWEKAVDI--EER-CGVGETGWGV   48 (146)
Q Consensus        19 Ar~R~~Rkk~WEkAvdi--~el-Cg~~~~WWGv   48 (146)
                      ||+=.-+.+.|++|++.  ++. +-.+|.||=-
T Consensus        47 ar~~~~s~~~~~~a~~~ll~~f~~~~dg~~~~~   79 (88)
T PF07120_consen   47 ARICGCSTKEWRKALDFLLREFFRLEDGRWWNK   79 (88)
T ss_pred             HHHHCcCHHHHHHHHHHHHHhCCCCCCCCEehH
Confidence            55556678899999984  444 7788888843


No 16 
>PF12845 TBD:  TBD domain;  InterPro: IPR024581 The Tbk1/Ikki binding domain (TBD) is a 40 amino acid domain able to bind kinases which is essential for poly(I:C)-induced IRF activation []. The domain is found in the SINTBAD, TANK and NAP1 proteins. This domain is predicted to form an alpha-helix with residues essential for kinase binding clustering on one side [].; PDB: 1KZZ_B 1L0A_B.
Probab=22.72  E-value=28  Score=23.91  Aligned_cols=10  Identities=30%  Similarity=0.338  Sum_probs=0.0

Q ss_pred             HHHHHHhhcC
Q 046989           76 ESILDVYREL   85 (146)
Q Consensus        76 eSiLd~YWEl   85 (146)
                      +.|..+||||
T Consensus         7 ~nl~~ay~EL   16 (57)
T PF12845_consen    7 VNLQLAYWEL   16 (57)
T ss_dssp             ----------
T ss_pred             HHHHHHHHHH
Confidence            3577899998


No 17 
>TIGR00981 rpsL_bact ribosomal protein S12, bacterial/organelle. This model recognizes ribosomal protein S12 of Bacteria, mitochondria, and chloroplasts. The homologous ribosomal proteins of Archaea and Eukarya, termed S23 in Eukarya and S12 or S23 in Archaea, score below the trusted cutoff.
Probab=21.94  E-value=40  Score=26.53  Aligned_cols=14  Identities=21%  Similarity=0.543  Sum_probs=10.8

Q ss_pred             CceeeCCCCCcCCC
Q 046989            1 LIHFYPSGGHSCLR   14 (146)
Q Consensus         1 ~~~~~~GGGHsC~~   14 (146)
                      +++||||-||+=..
T Consensus        63 v~AyIPG~Ghnlqe   76 (124)
T TIGR00981        63 VTAYIPGEGHNLQE   76 (124)
T ss_pred             EEEEcCCCCCCccc
Confidence            36999999997543


No 18 
>PF11943 DUF3460:  Protein of unknown function (DUF3460);  InterPro: IPR021853  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are about 70 amino acids in length. This protein has a conserved WDK sequence motif. 
Probab=21.82  E-value=48  Score=23.15  Aligned_cols=23  Identities=39%  Similarity=0.632  Sum_probs=19.8

Q ss_pred             cHHHHHHHHHHHHHHHhhchhhh
Q 046989           16 SDEARIRAKRKKFWEKAVDIEER   38 (146)
Q Consensus        16 S~EAr~R~~Rkk~WEkAvdi~el   38 (146)
                      .-|++-|.-|.-.|+|.+|.++.
T Consensus        20 ele~~Q~~GRallWDk~~d~e~~   42 (60)
T PF11943_consen   20 ELEEEQRAGRALLWDKPQDLEEQ   42 (60)
T ss_pred             chHHHHHHhhHHhcCCCCCHHHH
Confidence            35788899999999999998875


No 19 
>cd00319 Ribosomal_S12_like Ribosomal protein S12-like family; composed of  prokaryotic 30S ribosomal protein S12, eukaryotic 40S ribosomal protein S23 and similar proteins. S12 and S23 are located at the interface of the large and small ribosomal subunits, adjacent to the decoding center. They play an important role in translocation during the peptide elongation step of protein synthesis. They are also involved in important RNA and protein interactions. Ribosomal protein S12 is essential for maintenance of a pretranslocation state and, together with S13, functions as a control element for the rRNA- and tRNA-driven movements of translocation. S23 interacts with domain III of the eukaryotic elongation factor 2 (eEF2), which catalyzes translocation. Mutations in S12 and S23 have been found to affect translational accuracy. Antibiotics such as streptomycin may also bind S12/S23 and cause the ribosome to misread the genetic code.
Probab=21.60  E-value=41  Score=25.33  Aligned_cols=13  Identities=23%  Similarity=0.575  Sum_probs=10.3

Q ss_pred             CceeeCCCCCcCC
Q 046989            1 LIHFYPSGGHSCL   13 (146)
Q Consensus         1 ~~~~~~GGGHsC~   13 (146)
                      +++||||=||+=.
T Consensus        48 v~ayIPg~Gh~lq   60 (95)
T cd00319          48 VTAYIPGEGHNLQ   60 (95)
T ss_pred             EEEECCCCCcccc
Confidence            3689999998743


No 20 
>PF14122 YokU:  YokU-like protein
Probab=21.23  E-value=19  Score=26.98  Aligned_cols=15  Identities=47%  Similarity=0.412  Sum_probs=11.3

Q ss_pred             HHHHHHHHhhcCCCC
Q 046989           74 FVESILDVYRELPPV   88 (146)
Q Consensus        74 ~veSiLd~YWElPPv   88 (146)
                      .+++--.+|||||--
T Consensus        10 a~~~~~tvyWeLpdG   24 (87)
T PF14122_consen   10 ASESESTVYWELPDG   24 (87)
T ss_pred             cccccceEEEEcCCC
Confidence            456667899999964


No 21 
>PF06983 3-dmu-9_3-mt:  3-demethylubiquinone-9 3-methyltransferase; PDB: 1U7I_A 1TSJ_A 1U69_D 3L20_B 3OMS_A.
Probab=20.62  E-value=48  Score=23.99  Aligned_cols=26  Identities=12%  Similarity=0.194  Sum_probs=17.9

Q ss_pred             HHHHHHhhchhhhccCCCcccccceeeccCCCC
Q 046989           26 KKFWEKAVDIEERCGVGETGWGVKEEMRGNFNH   58 (146)
Q Consensus        26 kk~WEkAvdi~elCg~~~~WWGvrG~mRDnFnh   58 (146)
                      ++.|+|-.      - +|.||+--|...|.|+=
T Consensus        86 ~~~f~~Ls------~-gG~~~~~~G~v~DkFGv  111 (116)
T PF06983_consen   86 DRIFDKLS------E-GGQWFSRYGWVTDKFGV  111 (116)
T ss_dssp             HHHHHHHH------T-TTETCCEEEEEE-TTS-
T ss_pred             HHHHHHHH------c-CCCccceeEEEEeCCCC
Confidence            46787743      3 34499999999999973


No 22 
>COG2764 PhnB Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.43  E-value=82  Score=24.31  Aligned_cols=49  Identities=20%  Similarity=0.254  Sum_probs=32.2

Q ss_pred             CCCCcCCCCcHHHHHHHHHHHHHHHhhchh--hhccCCCcccccc-eeeccCCCCC
Q 046989            7 SGGHSCLRDSDEARIRAKRKKFWEKAVDIE--ERCGVGETGWGVK-EEMRGNFNHS   59 (146)
Q Consensus         7 GGGHsC~~~S~EAr~R~~Rkk~WEkAvdi~--elCg~~~~WWGvr-G~mRDnFnhs   59 (146)
                      |+|=+++.+.+.-.    =+..|+||++--  ..=-...+-||-| |+.+|.|+|.
T Consensus        74 ~~~~s~~l~~~~~d----~da~f~~a~~aGa~v~mpl~~~fwG~r~G~v~D~fGv~  125 (136)
T COG2764          74 GGGTSLSLDLYVED----VDAVFERAAAAGATVVMPLEDTFWGDRYGQVTDPFGVV  125 (136)
T ss_pred             CCCeeEEEEEEehH----HHHHHHHHHhcCCeEEecchhcCcccceEEEECCCCCE
Confidence            55566665554333    356899998864  2222356788865 8999999985


No 23 
>cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=20.10  E-value=1e+02  Score=19.99  Aligned_cols=52  Identities=19%  Similarity=0.147  Sum_probs=30.1

Q ss_pred             CCCCCcCCCCcHHHHHHHHHHHHHHHhhchhhhccCCCcccccceeeccCCCCC
Q 046989            6 PSGGHSCLRDSDEARIRAKRKKFWEKAVDIEERCGVGETGWGVKEEMRGNFNHS   59 (146)
Q Consensus         6 ~GGGHsC~~~S~EAr~R~~Rkk~WEkAvdi~elCg~~~~WWGvrG~mRDnFnhs   59 (146)
                      +|+.|-|+.-.+...+....++.=++.+++..  .+...-||-..+++|-.+|.
T Consensus        58 ~~~~~~~~~v~~~~~~~~~~~~~~~~g~~v~~--~~~~~~~g~~~~~~DPdGn~  109 (114)
T cd07261          58 GGGSELAFMVDDGAAVDALYAEWQAKGVKIIQ--EPTEMDFGYTFVALDPDGHR  109 (114)
T ss_pred             CCceEEEEEcCCHHHHHHHHHHHHHCCCeEec--CccccCCccEEEEECCCCCE
Confidence            36678888665422233333333344455443  34455788888999988774


No 24 
>COG4110 Uncharacterized protein involved in stress response [General function prediction only]
Probab=20.09  E-value=65  Score=27.19  Aligned_cols=31  Identities=32%  Similarity=0.622  Sum_probs=27.3

Q ss_pred             cccccchhhHHHhhccccccccccceeeEEEEEeccC
Q 046989          108 ILEDGRNGLFQRLRLARLETSVFNGYTQMVYLQISEQ  144 (146)
Q Consensus       108 i~~dg~~~lF~~lGL~~l~~~vFn~YtQM~Y~~i~~~  144 (146)
                      .|.||.+++-|.||      +.|..|----|++|++.
T Consensus        59 ~LnDGskGviQALG------N~FGSy~~~Pyi~LdgD   89 (200)
T COG4110          59 ELNDGSKGVIQALG------NAFGSYRDEPYVQLDGD   89 (200)
T ss_pred             EecCCchHHHHHHh------hhhcccccCceEEecCC
Confidence            36799999999999      68999999999999764


Done!