BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 047005
         (190 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1O0X|A Chain A, Crystal Structure Of Methionine Aminopeptidase (Tm1478)
           From Thermotoga Maritima At 1.90 A Resolution
          Length = 262

 Score = 26.9 bits (58), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 10/84 (11%)

Query: 103 QTTNVVIGGTVADDSTNEWLALDRKVNSYPTVRGFTAIGSGGDDFVQAMVVAVESVIQKP 162
           +   V++ G  A D     L + +K+   P  +G+     GG  +   + V  E V   P
Sbjct: 38  EVRKVIVPGKTAWDVETLVLEIFKKLRVKPAFKGY-----GGYKYATCVSVNEEVVHGLP 92

Query: 163 IPEGRVKQKVSSRGKYVSVNIGPV 186
           +     K+KV   G  VSV++G V
Sbjct: 93  L-----KEKVFKEGDIVSVDVGAV 111


>pdb|3AAW|A Chain A, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Lysine And Threonine
 pdb|3AAW|C Chain C, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Lysine And Threonine
 pdb|3AB2|A Chain A, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|C Chain C, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|E Chain E, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|G Chain G, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|I Chain I, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|K Chain K, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|M Chain M, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|O Chain O, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
          Length = 421

 Score = 26.6 bits (57), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 106 NVVIGGTVADDSTNEWLALDRKVNSYPTVRGFTAIGSGGDDFVQAMV-VAVESV 158
           +VV+  +   D+T+E L L   VN  P  R    + + G+    A+V +A+ES+
Sbjct: 35  DVVVVCSAMGDTTDELLELAAAVNPVPPAREMDMLLTAGERISNALVAMAIESL 88


>pdb|3AB4|A Chain A, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|C Chain C, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|E Chain E, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|G Chain G, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|I Chain I, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|K Chain K, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|M Chain M, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|O Chain O, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
          Length = 421

 Score = 26.6 bits (57), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 106 NVVIGGTVADDSTNEWLALDRKVNSYPTVRGFTAIGSGGDDFVQAMV-VAVESV 158
           +VV+  +   D+T+E L L   VN  P  R    + + G+    A+V +A+ES+
Sbjct: 35  DVVVVCSAMGDTTDELLELAAAVNPVPPAREMDMLLTAGERISNALVAMAIESL 88


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.131    0.380 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,354,913
Number of Sequences: 62578
Number of extensions: 202116
Number of successful extensions: 467
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 467
Number of HSP's gapped (non-prelim): 4
length of query: 190
length of database: 14,973,337
effective HSP length: 93
effective length of query: 97
effective length of database: 9,153,583
effective search space: 887897551
effective search space used: 887897551
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)