BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 047037
         (85 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2I14|A Chain A, Crystal Structure Of Nicotinate-Nucleotide
           Pyrophosphorylase From Pyrococcus Furiosus
 pdb|2I14|B Chain B, Crystal Structure Of Nicotinate-Nucleotide
           Pyrophosphorylase From Pyrococcus Furiosus
 pdb|2I14|C Chain C, Crystal Structure Of Nicotinate-Nucleotide
           Pyrophosphorylase From Pyrococcus Furiosus
 pdb|2I14|D Chain D, Crystal Structure Of Nicotinate-Nucleotide
           Pyrophosphorylase From Pyrococcus Furiosus
 pdb|2I14|E Chain E, Crystal Structure Of Nicotinate-Nucleotide
           Pyrophosphorylase From Pyrococcus Furiosus
 pdb|2I14|F Chain F, Crystal Structure Of Nicotinate-Nucleotide
           Pyrophosphorylase From Pyrococcus Furiosus
          Length = 395

 Score = 25.4 bits (54), Expect = 8.0,   Method: Composition-based stats.
 Identities = 12/45 (26%), Positives = 24/45 (53%)

Query: 2   DDVCENATPKISLHDVARDQVLETMRIQGSIKGKSVVILIDSGST 46
           D+V E   P+I+L D   D+ +E +    ++  K   + +D+ S+
Sbjct: 201 DEVIEEEVPRIALVDTFYDEKVEAVMAAEALGKKLFAVRLDTPSS 245


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.128    0.348 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,125,303
Number of Sequences: 62578
Number of extensions: 59705
Number of successful extensions: 97
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 95
Number of HSP's gapped (non-prelim): 2
length of query: 85
length of database: 14,973,337
effective HSP length: 53
effective length of query: 32
effective length of database: 11,656,703
effective search space: 373014496
effective search space used: 373014496
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 45 (21.9 bits)