BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 047037
(85 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2I14|A Chain A, Crystal Structure Of Nicotinate-Nucleotide
Pyrophosphorylase From Pyrococcus Furiosus
pdb|2I14|B Chain B, Crystal Structure Of Nicotinate-Nucleotide
Pyrophosphorylase From Pyrococcus Furiosus
pdb|2I14|C Chain C, Crystal Structure Of Nicotinate-Nucleotide
Pyrophosphorylase From Pyrococcus Furiosus
pdb|2I14|D Chain D, Crystal Structure Of Nicotinate-Nucleotide
Pyrophosphorylase From Pyrococcus Furiosus
pdb|2I14|E Chain E, Crystal Structure Of Nicotinate-Nucleotide
Pyrophosphorylase From Pyrococcus Furiosus
pdb|2I14|F Chain F, Crystal Structure Of Nicotinate-Nucleotide
Pyrophosphorylase From Pyrococcus Furiosus
Length = 395
Score = 25.4 bits (54), Expect = 8.0, Method: Composition-based stats.
Identities = 12/45 (26%), Positives = 24/45 (53%)
Query: 2 DDVCENATPKISLHDVARDQVLETMRIQGSIKGKSVVILIDSGST 46
D+V E P+I+L D D+ +E + ++ K + +D+ S+
Sbjct: 201 DEVIEEEVPRIALVDTFYDEKVEAVMAAEALGKKLFAVRLDTPSS 245
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.314 0.128 0.348
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,125,303
Number of Sequences: 62578
Number of extensions: 59705
Number of successful extensions: 97
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 95
Number of HSP's gapped (non-prelim): 2
length of query: 85
length of database: 14,973,337
effective HSP length: 53
effective length of query: 32
effective length of database: 11,656,703
effective search space: 373014496
effective search space used: 373014496
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 45 (21.9 bits)