BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 047091
(229 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4II2|A Chain A, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1)
In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg
pdb|4II3|A Chain A, Crystal Structure Of S. Pombe Ubiquitin Activating Enzyme
1 (uba1) In Complex With Ubiquitin And Atp/mg
pdb|4II3|C Chain C, Crystal Structure Of S. Pombe Ubiquitin Activating Enzyme
1 (uba1) In Complex With Ubiquitin And Atp/mg
Length = 1001
Score = 29.6 bits (65), Expect = 1.3, Method: Compositional matrix adjust.
Identities = 14/45 (31%), Positives = 26/45 (57%)
Query: 21 QAVNQESTNLHSTAVVLLNTRMLKSISSVKEMVKPDSKAPWGNHF 65
+ V + + STAV ++N + I+S +E V P+S+ +G+ F
Sbjct: 470 RDVGKLKSECASTAVSIMNPSLTGKITSYQERVGPESEGIFGDEF 514
>pdb|2VZ8|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase
pdb|2VZ8|B Chain B, Crystal Structure Of Mammalian Fatty Acid Synthase
pdb|2VZ9|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase In
Complex With Nadp
pdb|2VZ9|B Chain B, Crystal Structure Of Mammalian Fatty Acid Synthase In
Complex With Nadp
Length = 2512
Score = 28.9 bits (63), Expect = 2.2, Method: Composition-based stats.
Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 14/44 (31%)
Query: 177 GNLRVSLG---AEE-----------GFIDSPKLKSCIENAFEMM 206
GNL++ LG A+E G +D+P LK+C++ A E M
Sbjct: 1194 GNLQLELGQVLAQERPLLCDDPLLSGLLDAPALKACVDTALENM 1237
>pdb|3GAC|A Chain A, Structure Of Mif With Hpp
pdb|3GAC|B Chain B, Structure Of Mif With Hpp
pdb|3GAC|C Chain C, Structure Of Mif With Hpp
pdb|3GAC|D Chain D, Structure Of Mif With Hpp
pdb|3GAC|E Chain E, Structure Of Mif With Hpp
pdb|3GAC|F Chain F, Structure Of Mif With Hpp
pdb|3GAD|A Chain A, Structure Of Apomif
pdb|3GAD|B Chain B, Structure Of Apomif
pdb|3GAD|C Chain C, Structure Of Apomif
pdb|3GAD|D Chain D, Structure Of Apomif
pdb|3GAD|E Chain E, Structure Of Apomif
pdb|3GAD|F Chain F, Structure Of Apomif
Length = 117
Score = 28.9 bits (63), Expect = 2.4, Method: Compositional matrix adjust.
Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%)
Query: 137 ITNMMGPVEKMTLANHAIKGLYFMVVGSPQSLVVTIVSYMGNLRVSLGAEEGFI 190
ITN+ P +K A I+ V+G P + +++ Y NLR S G+ EG+
Sbjct: 6 ITNISIPDDKAQNALSEIEDAISNVLGKPVAYIMSNYDYQKNLRFS-GSNEGYC 58
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.129 0.359
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,548,469
Number of Sequences: 62578
Number of extensions: 184640
Number of successful extensions: 489
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 487
Number of HSP's gapped (non-prelim): 5
length of query: 229
length of database: 14,973,337
effective HSP length: 95
effective length of query: 134
effective length of database: 9,028,427
effective search space: 1209809218
effective search space used: 1209809218
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)