BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 047091
         (229 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4II2|A Chain A, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1)
           In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg
 pdb|4II3|A Chain A, Crystal Structure Of S. Pombe Ubiquitin Activating Enzyme
           1 (uba1) In Complex With Ubiquitin And Atp/mg
 pdb|4II3|C Chain C, Crystal Structure Of S. Pombe Ubiquitin Activating Enzyme
           1 (uba1) In Complex With Ubiquitin And Atp/mg
          Length = 1001

 Score = 29.6 bits (65), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 26/45 (57%)

Query: 21  QAVNQESTNLHSTAVVLLNTRMLKSISSVKEMVKPDSKAPWGNHF 65
           + V +  +   STAV ++N  +   I+S +E V P+S+  +G+ F
Sbjct: 470 RDVGKLKSECASTAVSIMNPSLTGKITSYQERVGPESEGIFGDEF 514


>pdb|2VZ8|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase
 pdb|2VZ8|B Chain B, Crystal Structure Of Mammalian Fatty Acid Synthase
 pdb|2VZ9|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase In
            Complex With Nadp
 pdb|2VZ9|B Chain B, Crystal Structure Of Mammalian Fatty Acid Synthase In
            Complex With Nadp
          Length = 2512

 Score = 28.9 bits (63), Expect = 2.2,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 14/44 (31%)

Query: 177  GNLRVSLG---AEE-----------GFIDSPKLKSCIENAFEMM 206
            GNL++ LG   A+E           G +D+P LK+C++ A E M
Sbjct: 1194 GNLQLELGQVLAQERPLLCDDPLLSGLLDAPALKACVDTALENM 1237


>pdb|3GAC|A Chain A, Structure Of Mif With Hpp
 pdb|3GAC|B Chain B, Structure Of Mif With Hpp
 pdb|3GAC|C Chain C, Structure Of Mif With Hpp
 pdb|3GAC|D Chain D, Structure Of Mif With Hpp
 pdb|3GAC|E Chain E, Structure Of Mif With Hpp
 pdb|3GAC|F Chain F, Structure Of Mif With Hpp
 pdb|3GAD|A Chain A, Structure Of Apomif
 pdb|3GAD|B Chain B, Structure Of Apomif
 pdb|3GAD|C Chain C, Structure Of Apomif
 pdb|3GAD|D Chain D, Structure Of Apomif
 pdb|3GAD|E Chain E, Structure Of Apomif
 pdb|3GAD|F Chain F, Structure Of Apomif
          Length = 117

 Score = 28.9 bits (63), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 137 ITNMMGPVEKMTLANHAIKGLYFMVVGSPQSLVVTIVSYMGNLRVSLGAEEGFI 190
           ITN+  P +K   A   I+     V+G P + +++   Y  NLR S G+ EG+ 
Sbjct: 6   ITNISIPDDKAQNALSEIEDAISNVLGKPVAYIMSNYDYQKNLRFS-GSNEGYC 58


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.129    0.359 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,548,469
Number of Sequences: 62578
Number of extensions: 184640
Number of successful extensions: 489
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 487
Number of HSP's gapped (non-prelim): 5
length of query: 229
length of database: 14,973,337
effective HSP length: 95
effective length of query: 134
effective length of database: 9,028,427
effective search space: 1209809218
effective search space used: 1209809218
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)