BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 047111
         (106 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3UXQ|I Chain I, The Structure Of Thermorubin In Complex With The 70s
           Ribosome From Thermus Thermophilus. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3UXR|I Chain I, The Structure Of Thermorubin In Complex With The 70s
           Ribosome From Thermus Thermophilus. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes
          Length = 148

 Score = 30.4 bits (67), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 15/91 (16%)

Query: 8   AARRLENARL--VLRRFPNIEKLRSRESKDDPIELCSPVTKEELVAKVASQLSISIEPEY 65
           A R+ E  RL  +L        +R+ E+K     +   VT +++   ++ Q  ++IEP+ 
Sbjct: 59  AERKAEAERLKEILENLTLTIPVRAGETK-----IYGSVTAKDIAEALSRQHGVTIEPKR 113

Query: 66  LHLPSPLSAFGEY--------EVPMRLSKTI 88
           L L  P+   GEY        EVP++L  ++
Sbjct: 114 LALEKPIKELGEYVLTYKPHPEVPIQLKVSV 144


>pdb|1VSA|G Chain G, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals
           Functional Interactions And Rearrangements. This File,
           1vsa, Contains The 50s Ribosome Subunit. 30s Ribosome
           Subunit Is In The File 2ow8
 pdb|1VSP|G Chain G, Interactions And Dynamics Of The Shine-Dalgarno Helix In
           The 70s Ribosome. This File, 1vsp, Contains The 50s
           Ribosome Subunit. 30s Ribosome Subunit Is In The File
           2qnh
 pdb|3D5B|I Chain I, Structural Basis For Translation Termination On The 70s
           Ribosome. This File Contains The 50s Subunit Of One 70s
           Ribosome. The Entire Crystal Structure Contains Two 70s
           Ribosomes As Described In Remark 400.
 pdb|3D5D|I Chain I, Structural Basis For Translation Termination On The 70s
           Ribosome. This File Contains The 50s Subunit Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes As Described In Remark 400.
 pdb|3F1F|I Chain I, Crystal Structure Of A Translation Termination Complex
           Formed With Release Factor Rf2. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes As Described In
           Remark 400.
 pdb|3F1H|I Chain I, Crystal Structure Of A Translation Termination Complex
           Formed With Release Factor Rf2. This File Contains The
           50s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes As
           Described In Remark 400.
 pdb|2WH4|I Chain I, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome
 pdb|3MRZ|H Chain H, Recognition Of The Amber Stop Codon By Release Factor Rf1.
           This Entry 3mrz Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 3ms0.
           Molecule A In The Same Asymmetric Unit Is Deposited As
           3mr8 (50s) And 3ms1 (30s).
 pdb|3MS1|H Chain H, Recognition Of The Amber Stop Codon By Release Factor Rf1.
           This Entry 3ms1 Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 3mr8.
           Molecule B In The Same Asymmetric Unit Is Deposited As
           3mrz (50s) And 3ms0 (30s)
          Length = 148

 Score = 30.0 bits (66), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 15/91 (16%)

Query: 8   AARRLENARL--VLRRFPNIEKLRSRESKDDPIELCSPVTKEELVAKVASQLSISIEPEY 65
           A R+ E  RL  +L        +R+ E+K     +   VT +++   ++ Q  I+I+P+ 
Sbjct: 59  AERKAEAERLKEILENLTLTIPVRAGETK-----IYGSVTAKDIAEALSRQHGITIDPKR 113

Query: 66  LHLPSPLSAFGEY--------EVPMRLSKTI 88
           L L  P+   GEY        EVP++L  ++
Sbjct: 114 LALEKPIKELGEYVLTYKPHPEVPIQLKVSV 144


>pdb|3PYO|H Chain H, Crystal Structure Of A Complex Containing Domain 3 From
           The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
           File Contains The 50s Subunit Of The First 70s Ribosome.
 pdb|3PYR|H Chain H, Crystal Structure Of A Complex Containing Domain 3 From
           The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
           File Contains The 50s Subunit Of The Second 70s
           Ribosome.
 pdb|3PYT|H Chain H, Crystal Structure Of A Complex Containing Domain 3 Of Crpv
           Igr Ires Rna Bound To The 70s Ribosome. This File
           Contains The 50s Subunit Of The First 70s Ribosome.
 pdb|3PYV|H Chain H, Crystal Structure Of A Complex Containing Domain 3 Of Crpv
           Igr Ires Rna Bound To The 70s Ribosome. This File
           Contains The 50s Subunit Of The Second 70s Ribosome
          Length = 145

 Score = 30.0 bits (66), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 15/91 (16%)

Query: 8   AARRLENARL--VLRRFPNIEKLRSRESKDDPIELCSPVTKEELVAKVASQLSISIEPEY 65
           A R+ E  RL  +L        +R+ E+K     +   VT +++   ++ Q  I+I+P+ 
Sbjct: 59  AERKAEAERLKEILENLTLTIPVRAGETK-----IYGSVTAKDIAEALSRQHGITIDPKR 113

Query: 66  LHLPSPLSAFGEY--------EVPMRLSKTI 88
           L L  P+   GEY        EVP++L  ++
Sbjct: 114 LALEKPIKELGEYVLTYKPHPEVPIQLKVSV 144


>pdb|2HGJ|K Chain K, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
           Showing How The 16s 3'-End Mimicks Mrna E And P Codons.
           This Entry 2hgj Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 2hgi.
 pdb|2HGQ|K Chain K, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
           With Translocated And Rotated Shine-Dalgarno Duplex.
           This Entry 2hgq Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 2hgp.
 pdb|2HGU|K Chain K, 70s T.Th. Ribosome Functional Complex With Mrna And E- And
           P-Site Trnas At 4.5a. This Entry 2hgu Contains 50s
           Ribosomal Subunit. The 30s Ribosomal Subunit Can Be
           Found In Pdb Entry 2hgr
          Length = 148

 Score = 29.6 bits (65), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 45/93 (48%), Gaps = 20/93 (21%)

Query: 4   EFEKAARRLENARLVLRRFPNIEKLRSRESKDDPIELCSPVTKEELVAKVASQLSISIEP 63
           E E+  + LEN  L +        +R+ E+K     +   VT +++   ++ Q  ++I+P
Sbjct: 64  EAERLKKILENLTLTI-------PVRAGETK-----IYGSVTAKDIAEALSRQHGVTIDP 111

Query: 64  EYLHLPSPLSAFGEY--------EVPMRLSKTI 88
           + L L  P+   GEY        EVP++L  ++
Sbjct: 112 KRLALEKPIKELGEYVLTYKPHPEVPIQLKVSV 144


>pdb|3FIN|I Chain I, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas
           And Ef- Tu.Gdp.Kirromycin Ternary Complex, Fitted To A
           6.4 A Cryo-Em Map. This File Contains The 50s Subunit
          Length = 146

 Score = 29.6 bits (65), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 46/98 (46%), Gaps = 12/98 (12%)

Query: 8   AARRLENARL--VLRRFPNIEKLRSRESKDDPIELCSPVTKEELVAKVASQLSISIEPEY 65
           A R+ E  RL  +L        +R+ E+K     +   VT +++   ++ Q  ++I+P+ 
Sbjct: 59  AERKAEAERLKEILENLTLTIPVRAGETK-----IYGSVTAKDIAEALSRQHGVTIDPKR 113

Query: 66  LHLPSPLSAFGEYEVPMRLSKTIPLPEGKVQWTFNVKV 103
           L L  P+   GEY +  +     P PE  +Q   +V V
Sbjct: 114 LALEKPIKELGEYVLTYK-----PHPEVPIQLKVSVVV 146


>pdb|2V47|I Chain I, Structure Of The Ribosome Recycling Factor Bound To The
           Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
           Trna-Fmet (Part 2 Of 4). This File Contains The 50s
           Subunit For Molecule 1.
 pdb|2V49|I Chain I, Structure Of The Ribosome Recycling Factor Bound To The
           Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
           Trna-Fmet (Part 4 Of 4). This File Contains The 50s
           Subunit Of Molecule 2.
 pdb|2WDI|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A-Site Trna,
           Deacylated P-Site Trna, And E-Site Trna. This File
           Contains The 50s Subunit For Molecule I.
 pdb|2WDJ|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A-Site Trna,
           Deacylated P-Site Trna, And E-Site Trna. This File
           Contains The 50s Subunit For Molecule Ii.
 pdb|2WDL|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A- And P-Site
           Trnas, And E-Site Trna.  This File Contains The 50s
           Subunit For Molecule I.
 pdb|2WDN|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A- And P-Site
           Trnas, And E-Site Trna.  This File Contains The 50s
           Subunit For Molecule Ii.
 pdb|2WH2|I Chain I, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome
 pdb|3HUX|I Chain I, Structure Of Ef-P Bound To The 70s Ribosome; This File
           Contains The 50s Subunit For Molecule I.
 pdb|3HUZ|I Chain I, Structure Of Ef-P Bound To The 70s Ribosome; This File
           Contains The 50s Subunit For Molecule Ii.
 pdb|3KIR|I Chain I, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Precleavage State; Part 2 Of 4)
 pdb|3KIT|I Chain I, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Precleavage State; Part 4 Of 4)
 pdb|3KIW|I Chain I, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Postcleavage State; Part 2 Of 4)
 pdb|3KIY|I Chain I, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Postcleavage State; Part 4 Of 4)
 pdb|3KNI|I Chain I, The Structures Of Viomycin Bound To The 70s Ribosome. This
           File Contains The 50s Subunit For Molecule I
 pdb|3KNK|I Chain I, The Structures Of Viomycin Bound To The 70s Ribosome. This
           File Contains The 50s Subunit For Molecule Ii.
 pdb|3KNM|I Chain I, The Structures Of Capreomycin Bound To The 70s Ribosome.
           Thi Contains The 50s Subunit For Molecule I.
 pdb|3KNO|I Chain I, The Structures Of Capreomycin Bound To The 70s Ribosome.
           Thi Contains The 50s Subunit For Molecule Ii
 pdb|3I8F|K Chain K, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8f Contains 50s Ribosomal Subunit. The 30s
           Ribosoma Can Be Found In Pdb Entry 3i8g. Molecule B In
           The Same Asym Unit Is Deposited As 3i8g (30s) And 3i8f
           (50s).
 pdb|3I8I|K Chain K, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8i Contains 50s Ribosomal Subnit. The 30s
           Ribosomal Can Be Found In Pdb Entry 3i8h. Molecule A In
           The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g
           (30s).
 pdb|3I9C|K Chain K, Initiation Complex Of 70s Ribosome With Two Trnas And
           Mrna. 3i9c Contains 50s Ribosomal Subunit Of Molecule B.
           The 30s Subunit Can Be Found In Pdb Entry 3i9b. Molecule
           A In The S Asymmetric Unit Is Deposited As 3i9d (30s)
           And 3i9e (50s)
 pdb|3I9E|K Chain K, Initiation Complex Of 70s Ribosome With Two Trnas And
           Mrna. 3i9e Contains 50s Ribosomal Subunit Of Molecule A.
           The 30s Subunit Can Be Found In Pdb Entry 3i9d. Molecule
           B In The S Asymmetric Unit Is Deposited As 3i9b (30s)
           And 3i9c (50s)
 pdb|2X9S|I Chain I, Structure Of The 70s Ribosome Bound To Release Factor 2
           And A Substrate Analog Provides Insights Into Catalysis
           Of Peptide Release
 pdb|2X9U|I Chain I, Structure Of The 70s Ribosome Bound To Release Factor 2
           And A Substrate Analog Provides Insights Into Catalysis
           Of Peptide Release
 pdb|2XG0|I Chain I, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
           70s Ribosome (Part 2 Of 4)
 pdb|2XG2|I Chain I, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
           70s Ribosome (Part 4 Of 4)
 pdb|3OH5|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Chloramphenicol. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OH7|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Chloramphenicol. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OHJ|I Chain I, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Erythromycin. This File Contains The 50s Subunit Of
           One 70s Ribosome. The Entire Crystal Structure Contains
           Two 70s Ribosomes.
 pdb|3OHK|I Chain I, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Erythromycin. This File Contains The 50s Subunit Of
           One 70s Ribosome. The Entire Crystal Structure Contains
           Two 70s Ribosomes.
 pdb|3OHZ|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Azithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OI1|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Azithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OI3|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Telithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OI5|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Telithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3UYE|K Chain K, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Leu Complex
 pdb|3UYG|K Chain K, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Leu Complex
 pdb|3UZ1|K Chain K, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Leu Complex With Paromomycin
 pdb|3UZ2|K Chain K, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Leu Complex With Paromomycin.
 pdb|3UZ8|K Chain K, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Cognate
           Trna-Tyr Complex.
 pdb|3UZ9|K Chain K, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Cognate
           Trna-Tyr Complex.
 pdb|3UZF|K Chain K, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Tyr Complex
 pdb|3UZH|K Chain K, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Tyr Complex.
 pdb|3UZK|K Chain K, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Tyr Complex With Paromomycin
 pdb|3UZN|K Chain K, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Near-cognate
           Trna-tyr Complex With Paromomycin
 pdb|4DHA|I Chain I, Crystal Structure Of Yaej Bound To The 70s Ribosome
 pdb|4DHC|I Chain I, Crystal Structure Of Yaej Bound To The 70s Ribosome
 pdb|3V23|I Chain I, Crystal Structure Of Rmf Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 50s Subunit Of
           The 1st Ribosome In The Asu
 pdb|3V25|I Chain I, Crystal Structure Of Rmf Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 50s Subunit Of
           The 2nd Ribosome In The Asu
 pdb|3V27|I Chain I, Crystal Structure Of Hpf Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 50s Subunit Of
           The 1st Ribosome In The Asu
 pdb|3V29|I Chain I, Crystal Structure Of Hpf Bound To The 70s Ribosome. This
           Entry Contains The 50s Subunit Of The 2nd Molecule In
           The Asu.
 pdb|3V2D|I Chain I, Crystal Structure Of Yfia Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 50s Subunit Of
           The 1st Ribosome In The Asu
 pdb|3V2F|I Chain I, Crystal Structure Of Yfia Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 50s Subunit Of
           The 2nd Ribosome In The Asu
 pdb|2J01|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4).
           This File Contains The 50s Subunit From Molecule I.
 pdb|2J03|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Mrna, Trna And Paromomycin (Part 4 Of 4).
           This File Contains The 50s Subunit From Molecule Ii.
 pdb|4G5L|K Chain K, Crystal Structure Of The 70s Ribosome With Tetracycline.
           This Entry Contains The 50s Subunit Of Molecule A.
 pdb|4G5N|K Chain K, Crystal Structure Of The 70s Ribosome With Tetracycline.
           This Entry Contains The 50s Subunit Of Molecule B.
 pdb|4G5U|K Chain K, Crystal Structure Of The 70s Ribosome With Tigecycline.
           This Entry Contains The 50s Subunit Of Molecule A.
 pdb|4G5W|K Chain K, Crystal Structure Of The 70s Ribosome With Tigecycline.
           This Entry Contains The 50s Subunit Of Molecule B
          Length = 148

 Score = 29.6 bits (65), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 15/91 (16%)

Query: 8   AARRLENARL--VLRRFPNIEKLRSRESKDDPIELCSPVTKEELVAKVASQLSISIEPEY 65
           A R+ E  RL  +L        +R+ E+K     +   VT +++   ++ Q  ++I+P+ 
Sbjct: 59  AERKAEAERLKEILENLTLTIPVRAGETK-----IYGSVTAKDIAEALSRQHGVTIDPKR 113

Query: 66  LHLPSPLSAFGEY--------EVPMRLSKTI 88
           L L  P+   GEY        EVP++L  ++
Sbjct: 114 LALEKPIKELGEYVLTYKPHPEVPIQLKVSV 144


>pdb|3TVE|K Chain K, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Cognate
           Trna-Leu Complex
 pdb|3TVH|K Chain K, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Cognate
           Trna-Leu Complex
          Length = 146

 Score = 29.6 bits (65), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 15/91 (16%)

Query: 8   AARRLENARL--VLRRFPNIEKLRSRESKDDPIELCSPVTKEELVAKVASQLSISIEPEY 65
           A R+ E  RL  +L        +R+ E+K     +   VT +++   ++ Q  ++I+P+ 
Sbjct: 59  AERKAEAERLKEILENLTLTIPVRAGETK-----IYGSVTAKDIAEALSRQHGVTIDPKR 113

Query: 66  LHLPSPLSAFGEY--------EVPMRLSKTI 88
           L L  P+   GEY        EVP++L  ++
Sbjct: 114 LALEKPIKELGEYVLTYKPHPEVPIQLKVSV 144


>pdb|2YV3|A Chain A, Crystal Structure Of Aspartate Semialdehyde Dehydrogenase
           From Thermus Thermophilus Hb8
 pdb|2YV3|B Chain B, Crystal Structure Of Aspartate Semialdehyde Dehydrogenase
           From Thermus Thermophilus Hb8
          Length = 331

 Score = 28.9 bits (63), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 38  IELCSPVTKEEL--VAKVASQLSISIEPEYLHLPSPLSAFGEYEVPM-RLSKTIPLPEG 93
           +E   PVT E    V K A  + +  EPE    P PL+A G+++V + R+ K++    G
Sbjct: 244 VEFARPVTPEAAREVLKEAPGVEVVDEPEAKRYPMPLTASGKWDVEVGRIRKSLAFENG 302


>pdb|1TXD|A Chain A, Crystal Structure Of The Dh/ph Domains Of
           Leukemia-associated Rhogef
 pdb|1X86|A Chain A, Crystal Structure Of The DhPH DOMAINS OF
           LEUKEMIA-Associated Rhogef In Complex With Rhoa
 pdb|1X86|C Chain C, Crystal Structure Of The DhPH DOMAINS OF
           LEUKEMIA-Associated Rhogef In Complex With Rhoa
 pdb|1X86|E Chain E, Crystal Structure Of The DhPH DOMAINS OF
           LEUKEMIA-Associated Rhogef In Complex With Rhoa
 pdb|1X86|G Chain G, Crystal Structure Of The DhPH DOMAINS OF
           LEUKEMIA-Associated Rhogef In Complex With Rhoa
          Length = 385

 Score = 26.6 bits (57), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 17/26 (65%)

Query: 5   FEKAARRLENARLVLRRFPNIEKLRS 30
            E   RRL+ + L L  +PN+E+LR+
Sbjct: 224 LEDYQRRLDTSSLKLSEYPNVEELRN 249


>pdb|3P9D|D Chain D, The Crystal Structure Of Yeast Cct Reveals Intrinsic
           Asymmetry Of Eukaryotic Cytosolic Chaperonins
 pdb|3P9D|L Chain L, The Crystal Structure Of Yeast Cct Reveals Intrinsic
           Asymmetry Of Eukaryotic Cytosolic Chaperonins
 pdb|3P9E|DD Chain d, The Crystal Structure Of Yeast Cct Reveals Intrinsic
           Asymmetry Of Eukaryotic Cytosolic Chaperonins
 pdb|3P9E|LL Chain l, The Crystal Structure Of Yeast Cct Reveals Intrinsic
           Asymmetry Of Eukaryotic Cytosolic Chaperonins
 pdb|4D8Q|D Chain D, Molecular Architecture Of The Eukaryotic Chaperonin
           TricCCT DERIVED By A Combination Of Chemical
           Crosslinking And Mass-Spectrometry, Xl- Ms
 pdb|4D8Q|L Chain L, Molecular Architecture Of The Eukaryotic Chaperonin
           TricCCT DERIVED By A Combination Of Chemical
           Crosslinking And Mass-Spectrometry, Xl- Ms
 pdb|4D8R|DD Chain d, Molecular Architecture Of The Eukaryotic Chaperonin
           TricCCT DERIVED By A Combination Of Chemical
           Crosslinking And Mass-Spectrometry, Xl- Ms
 pdb|4D8R|LL Chain l, Molecular Architecture Of The Eukaryotic Chaperonin
           TricCCT DERIVED By A Combination Of Chemical
           Crosslinking And Mass-Spectrometry, Xl- Ms
          Length = 528

 Score = 25.8 bits (55), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 30  SRESKDDPIELCSPVT---KEELVAKVASQLSISIEPEYLHLPSPLSAFGEYEVPMRLSK 86
           ++ S D  +E+C  V+   +E+LV   ++ LS  I  +Y    +PL+     ++    SK
Sbjct: 128 AKRSVDILLEMCHKVSLSDREQLVRAASTSLSSKIVSQYSSFLAPLAVDSVLKISDENSK 187

Query: 87  TIPLPE 92
            + L +
Sbjct: 188 NVDLND 193


>pdb|3BBO|D Chain D, Homology Model For The Spinach Chloroplast 50s Subunit
           Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome
          Length = 352

 Score = 25.0 bits (53), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 7   KAARRLENARLVLRRFPNIEKLRSRESKDD---PIELCSPVTKEELVAKVASQLSISIEP 63
           KAA  L++ R   +RF  I+KLR  + + D    + L   ++  + V    +   ++I+P
Sbjct: 107 KAALPLKSDRTRSKRFLEIQKLREIKQEYDLKTALSLMKQMSSTKFVETAEAHFRLNIDP 166

Query: 64  EY 65
           +Y
Sbjct: 167 KY 168


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.133    0.378 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,971,063
Number of Sequences: 62578
Number of extensions: 102386
Number of successful extensions: 219
Number of sequences better than 100.0: 16
Number of HSP's better than 100.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 208
Number of HSP's gapped (non-prelim): 16
length of query: 106
length of database: 14,973,337
effective HSP length: 71
effective length of query: 35
effective length of database: 10,530,299
effective search space: 368560465
effective search space used: 368560465
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 45 (21.9 bits)