Citrus Sinensis ID: 047119


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230---
MSFSNFLFLSALSSFILWSTSIDATVFEVQNNCSYTVWAAANPSGGRELYQGQSWIVNTDPNFNDIGRIWARINCRFNVSNGTGKCESGDCNGVLYCVSDGAPPVILAEYSFQGVNNMGFFDVSVVDGFNVPIEFKGTSSGCNKVIKCRGDINGLCPTELRHPGGCNHPCSVLKNDQFCCTCSNSTATNCGPTTAYFKIFKDLCPDAYSYALDDATSTFTCPTGTDYKVVFCP
cccHHHHHHHHHHHHHHHHHccccEEEEEEEcccccEEEEEccccccccccccEEEEEccccccccEEEEEEccccccccccccccccccccccCCccccccccccEEEEEEEccccccEEEccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccEEccccccEEEEEcc
****NFLFLSALSSFILWSTSIDATVFEVQNNCSYTVWAAANPSGGRELYQGQSWIVNTDPNFNDIGRIWARINCRFNVSNGTGKCESGDCNGVLYCVSDGAPPVILAEYSFQGVNNMGFFDVSVVDGFNVPIEFKGTSSGCNKVIKCRGDINGLCPTELRHPGGCNHPCSVLKNDQFCCTCSNSTATNCGPTTAYFKIFKDLCPDAYSYALDDATSTFTCPTGTDYKVVFCP
xxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFSNFLFLSALSSFILWSTSIDATVFEVQNNCSYTVWAAANPSGGRELYQGQSWIVNTDPNFNDIGRIWARINCRFNVSNGTGKCESGDCNGVLYCVSDGAPPVILAEYSFQGVNNMGFFDVSVVDGFNVPIEFKGTSSGCNKVIKCRGDINGLCPTELRHPGGCNHPCSVLKNDQFCCTCSNSTATNCGPTTAYFKIFKDLCPDAYSYALDDATSTFTCPTGTDYKVVFCP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein P21 probableP25096
Zeamatin Has antifungal activity. Inhibits Candida albicans and Trichoderma reesei; marginal inhibition observed against Alternaria solani and Neurospora crassa.probableP33679
Thaumatin-like protein Has antifungal activity.probableP81370

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DU5, chain A
Confidence level:very confident
Coverage over the Query: 25-233
View the alignment between query and template
View the model in PyMOL