Citrus Sinensis ID: 047153

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MEIDRADGRNPNQLRPLACYCSILHRAHGSASWSQGDTKVLAAKNENPEKVSIEVIWKSKTGQIGKQEKEYEMILKRTLQSICILTINPNTTTSVIIQVW
ccccccccccccccccEEEEEcccccccCEEEEEEccEEEEEEEcccccCEEEEEEEEccccccccHHHHHHHHHHHHHHHHHccccccccEEEEEEEEc
********RNPNQLRPLACYCSILHRAHGSASWSQGDTKVLAAKNENPEKVSIEVIWKSKTGQIGKQEKEYEMILKRTLQSICILTINPNTTTSVIIQVW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEIDRADGRNPNQLRPLACYCSILHRAHGSASWSQGDTKVLAAKNENPEKVSIEVIWKSKTGQIGKQEKEYEMILKRTLQSICILTINPNTTTSVIIQVW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Exosome complex exonuclease RRP46 homolog Probable component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3'-untranslated regions. May form a homodimer separately from exosome complexes and function in DNA cleavage process. Binds double-stranded DNA (dsDNA) and single-stranded RNA (ssRNA), and possesses hydrolytic DNase and phosphorolytic RNase activities in vitro.probableQ84T68

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HKM, chain A
Confidence level:very confident
Coverage over the Query: 5-100
View the alignment between query and template
View the model in PyMOL