Query         047174
Match_columns 80
No_of_seqs    30 out of 32
Neff          2.8 
Searched_HMMs 46136
Date          Fri Mar 29 08:27:28 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/047174.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/047174hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF13405 EF-hand_6:  EF-hand do  96.8  0.0011 2.4E-08   34.7   2.2   18   59-76      2-19  (31)
  2 PF00036 EF-hand_1:  EF hand;    96.7  0.0013 2.8E-08   35.3   2.1   18   59-76      2-19  (29)
  3 PF13202 EF-hand_5:  EF hand; P  96.2  0.0044 9.6E-08   32.1   2.1   18   59-76      1-18  (25)
  4 PF13499 EF-hand_7:  EF-hand do  95.1   0.021 4.5E-07   32.8   2.3   19   58-76      1-19  (66)
  5 cd05026 S-100Z S-100Z: S-100Z   94.1   0.049 1.1E-06   34.7   2.4   25   52-76      5-31  (93)
  6 smart00054 EFh EF-hand, calciu  94.0   0.062 1.3E-06   24.4   2.1   18   59-76      2-19  (29)
  7 smart00027 EH Eps15 homology d  93.0     0.1 2.2E-06   32.7   2.6   25   53-77      6-30  (96)
  8 cd05022 S-100A13 S-100A13: S-1  92.6    0.12 2.6E-06   33.5   2.6   24   53-76      4-28  (89)
  9 cd05027 S-100B S-100B: S-100B   92.1    0.15 3.3E-06   32.5   2.5   23   54-76      5-29  (88)
 10 cd05025 S-100A1 S-100A1: S-100  92.0    0.15 3.4E-06   31.7   2.4   25   52-76      4-30  (92)
 11 cd05031 S-100A10_like S-100A10  91.7    0.17 3.8E-06   31.6   2.4   26   51-76      2-29  (94)
 12 KOG0027 Calmodulin and related  91.6    0.21 4.6E-06   33.4   2.9   24   53-76      4-27  (151)
 13 cd00213 S-100 S-100: S-100 dom  91.2    0.21 4.5E-06   30.5   2.3   25   52-76      3-29  (88)
 14 PF13499 EF-hand_7:  EF-hand do  90.7    0.39 8.5E-06   27.4   3.1   22   55-76     38-59  (66)
 15 PTZ00183 centrin; Provisional   90.1    0.33 7.1E-06   31.0   2.6   24   53-76     13-36  (158)
 16 PF13833 EF-hand_8:  EF-hand do  89.9    0.25 5.3E-06   27.6   1.7   23   54-76     22-44  (54)
 17 PTZ00184 calmodulin; Provision  89.5     0.5 1.1E-05   29.5   3.1   39   37-75     64-102 (149)
 18 KOG0037 Ca2+-binding protein,   89.1    0.16 3.5E-06   39.1   0.7   26   54-79    121-146 (221)
 19 cd05029 S-100A6 S-100A6: S-100  88.2    0.47   1E-05   30.3   2.4   25   52-76      5-31  (88)
 20 PTZ00184 calmodulin; Provision  87.5    0.61 1.3E-05   29.1   2.6   24   53-76      7-30  (149)
 21 cd00051 EFh EF-hand, calcium b  87.2    0.51 1.1E-05   24.4   1.7   17   59-75      2-18  (63)
 22 KOG0027 Calmodulin and related  87.1    0.26 5.5E-06   33.0   0.7   42   37-78     61-106 (151)
 23 cd00052 EH Eps15 homology doma  85.2    0.57 1.2E-05   26.2   1.4   21   56-76     32-52  (67)
 24 KOG0041 Predicted Ca2+-binding  84.5    0.65 1.4E-05   36.4   1.9   63   16-78     52-120 (244)
 25 PTZ00183 centrin; Provisional   83.8    0.76 1.7E-05   29.3   1.7   20   57-76     90-109 (158)
 26 cd05022 S-100A13 S-100A13: S-1  82.6     1.9 4.1E-05   27.9   3.2   51   25-76     10-66  (89)
 27 KOG0044 Ca2+ sensor (EF-Hand s  82.2     1.2 2.5E-05   33.1   2.3   38   37-75     44-82  (193)
 28 KOG4403 Cell surface glycoprot  82.1    0.98 2.1E-05   38.8   2.1   31   47-77     54-88  (575)
 29 cd05025 S-100A1 S-100A1: S-100  81.3     1.5 3.2E-05   27.2   2.2   21   56-76     51-71  (92)
 30 cd05026 S-100Z S-100Z: S-100Z   80.9     1.5 3.2E-05   27.8   2.2   58   19-76      3-72  (93)
 31 cd05023 S-100A11 S-100A11: S-1  79.3     2.2 4.7E-05   27.3   2.6   26   50-75      2-29  (89)
 32 COG5126 FRQ1 Ca2+-binding prot  75.8     2.8   6E-05   30.5   2.6   30   46-75      8-38  (160)
 33 cd05031 S-100A10_like S-100A10  74.4       3 6.6E-05   26.0   2.2   53   24-76      9-70  (94)
 34 cd05030 calgranulins Calgranul  73.7       3 6.6E-05   26.1   2.1   21   56-76     50-70  (88)
 35 cd00252 SPARC_EC SPARC_EC; ext  73.0     3.2 6.8E-05   28.2   2.2   22   54-75     45-66  (116)
 36 cd05029 S-100A6 S-100A6: S-100  71.0       4 8.7E-05   25.9   2.2   56   19-76      3-70  (88)
 37 smart00027 EH Eps15 homology d  70.6      10 0.00022   23.6   4.0   21   56-76     43-63  (96)
 38 cd05023 S-100A11 S-100A11: S-1  66.5     5.3 0.00011   25.5   2.1   20   57-76     52-71  (89)
 39 COG3382 Solo B3/4 domain (OB-f  60.5     6.2 0.00013   30.5   1.8   21   26-46     84-104 (229)
 40 KOG0044 Ca2+ sensor (EF-Hand s  60.1     4.3 9.2E-05   30.1   0.9   18   58-75    101-118 (193)
 41 COG5126 FRQ1 Ca2+-binding prot  53.5     6.5 0.00014   28.6   0.9   25   53-77     88-112 (160)
 42 PRK12309 transaldolase/EF-hand  52.0      14 0.00031   29.8   2.7   16   59-74    359-374 (391)
 43 PF04367 DUF502:  Protein of un  51.2      14 0.00031   24.2   2.2   37   37-73     22-58  (108)
 44 PF14788 EF-hand_10:  EF hand;   50.5      18 0.00038   22.2   2.3   24   52-75     16-39  (51)
 45 KOG1707 Predicted Ras related/  48.1      10 0.00022   33.3   1.4   39   37-76    285-334 (625)
 46 TIGR03296 M6dom_TIGR03296 M6 f  48.0     8.4 0.00018   29.1   0.8   15   62-76     91-105 (286)
 47 PLN02964 phosphatidylserine de  47.4      14 0.00031   32.0   2.1   39   37-76    196-234 (644)
 48 PRK12309 transaldolase/EF-hand  45.8      20 0.00043   29.1   2.6   50   23-75    299-352 (391)
 49 KOG0036 Predicted mitochondria  43.2      21 0.00046   30.4   2.5   28   50-77      7-34  (463)
 50 KOG0034 Ca2+/calmodulin-depend  43.0      18 0.00039   26.5   1.8   23   54-76    143-166 (187)
 51 PF09631 Sen15:  Sen15 protein;  42.1      17 0.00037   23.6   1.4   13   55-67     54-66  (101)
 52 cd05024 S-100A10 S-100A10: A s  37.8      30 0.00066   23.0   2.1   19   57-75     48-66  (91)
 53 PF10384 Scm3:  Centromere prot  36.9      38 0.00082   21.0   2.3   20   60-79     19-39  (58)
 54 PLN02964 phosphatidylserine de  35.4      35 0.00075   29.7   2.6   21   54-74    140-160 (644)
 55 KOG0028 Ca2+-binding protein (  35.4      39 0.00085   25.5   2.6   38   37-75     86-124 (172)
 56 PF10234 Cluap1:  Clusterin-ass  35.0      31 0.00068   27.0   2.1   44   15-66    193-241 (267)
 57 PF09422 WTX:  WTX protein;  In  34.5      12 0.00026   31.8  -0.2   22   37-69    247-268 (471)
 58 PF07994 NAD_binding_5:  Myo-in  34.2      19 0.00041   28.1   0.9   42   24-67    247-288 (295)
 59 KOG0030 Myosin essential light  33.1      40 0.00086   25.0   2.3   24   53-76      7-30  (152)
 60 KOG0028 Ca2+-binding protein (  32.9      28 0.00061   26.2   1.5   27   51-77     27-53  (172)
 61 PF01023 S_100:  S-100/ICaBP ty  30.3      69  0.0015   18.4   2.6   13   54-66      3-15  (44)
 62 cd06399 PB1_P40 The PB1 domain  29.5      34 0.00073   23.6   1.3   21   47-67     25-45  (92)
 63 PF10923 DUF2791:  P-loop Domai  29.2      88  0.0019   25.8   3.9   46   25-70    302-356 (416)
 64 smart00386 HAT HAT (Half-A-TPR  29.1      50  0.0011   15.3   1.6   11   56-66      3-13  (33)
 65 PF13767 DUF4168:  Domain of un  28.2      27 0.00059   21.6   0.7   38    8-48     30-67  (78)
 66 PF13174 TPR_6:  Tetratricopept  28.1      22 0.00048   17.0   0.2   15   37-51     18-32  (33)
 67 PF08987 DUF1892:  Protein of u  28.1      40 0.00087   24.0   1.6   36   41-78     38-87  (115)
 68 PF02184 HAT:  HAT (Half-A-TPR)  27.6      50  0.0011   18.6   1.6   11   56-66      3-13  (32)
 69 PF03520 KCNQ_channel:  KCNQ vo  27.4      21 0.00044   27.5   0.0   28   46-76     79-112 (202)
 70 PF10591 SPARC_Ca_bdg:  Secrete  27.2      33 0.00071   22.9   1.0   20   57-76     54-73  (113)
 71 PF05465 Halo_GVPC:  Halobacter  25.3      42 0.00091   18.5   1.0   18   51-68     10-27  (32)
 72 PF08338 DUF1731:  Domain of un  24.9      37 0.00081   19.8   0.8   15   45-59     33-47  (48)
 73 KOG0031 Myosin regulatory ligh  24.5      59  0.0013   24.6   2.0   20   57-76    101-120 (171)
 74 PF09912 DUF2141:  Uncharacteri  24.0      31 0.00067   22.9   0.4   11   66-76     61-71  (112)
 75 PF11043 DUF2856:  Protein of u  23.8      55  0.0012   22.6   1.6   48   16-63     37-91  (97)
 76 PF14424 Toxin-deaminase:  The   22.7 1.2E+02  0.0026   21.1   3.1   47   19-70     74-122 (133)
 77 PF15386 Tantalus:  Drosophila   22.7      32 0.00068   21.8   0.2   22   57-78     36-57  (61)
 78 PF08706 D5_N:  D5 N terminal l  21.6      71  0.0015   20.1   1.7   27   51-77     74-111 (150)
 79 cd01612 APG12_C Ubiquitin-like  21.2      74  0.0016   20.6   1.7   58   11-75     17-77  (87)
 80 KOG0061 Transporter, ABC super  20.9 1.1E+02  0.0023   25.9   3.0   29    8-38    194-222 (613)
 81 PF08181 DegQ:  DegQ (SacQ) fam  20.8      81  0.0017   19.3   1.7   16   53-68     24-39  (46)
 82 PF02171 Piwi:  Piwi domain;  I  20.4 2.5E+02  0.0055   20.4   4.5   59   20-79    127-194 (302)

No 1  
>PF13405 EF-hand_6:  EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B ....
Probab=96.81  E-value=0.0011  Score=34.71  Aligned_cols=18  Identities=11%  Similarity=0.067  Sum_probs=15.5

Q ss_pred             HHHHHHhhcCCCCCceee
Q 047174           59 CKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        59 ~R~vFeqfDeDsnGti~~   76 (80)
                      ++.+|++||.|.||.|+.
T Consensus         2 l~~~F~~~D~d~dG~I~~   19 (31)
T PF13405_consen    2 LREAFKMFDKDGDGFIDF   19 (31)
T ss_dssp             HHHHHHHH-TTSSSEEEH
T ss_pred             HHHHHHHHCCCCCCcCcH
Confidence            688999999999999975


No 2  
>PF00036 EF-hand_1:  EF hand;  InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand. This type of domain consists of a twelve residue loop flanked on both sides by a twelve residue alpha-helical domain. In an EF-hand loop the calcium ion is coordinated in a pentagonal bipyramidal configuration. The six residues involved in the binding are in positions 1, 3, 5, 7, 9 and 12; these residues are denoted by X, Y, Z, -Y, -X and -Z. The invariant Glu or Asp at position 12 provides two oxygens for liganding Ca (bidentate ligand).; PDB: 1BJF_A 1XFW_R 1XFV_O 2K0J_A 2F3Z_A 3BYA_A 1XFU_Q 2R28_B 1ZOT_B 3G43_D ....
Probab=96.74  E-value=0.0013  Score=35.26  Aligned_cols=18  Identities=17%  Similarity=0.034  Sum_probs=16.5

Q ss_pred             HHHHHHhhcCCCCCceee
Q 047174           59 CKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        59 ~R~vFeqfDeDsnGti~~   76 (80)
                      ++.+|+.||.|.||.|+.
T Consensus         2 ~~~~F~~~D~d~dG~I~~   19 (29)
T PF00036_consen    2 LKEAFREFDKDGDGKIDF   19 (29)
T ss_dssp             HHHHHHHHSTTSSSEEEH
T ss_pred             HHHHHHHHCCCCCCcCCH
Confidence            788999999999999974


No 3  
>PF13202 EF-hand_5:  EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A ....
Probab=96.20  E-value=0.0044  Score=32.07  Aligned_cols=18  Identities=17%  Similarity=0.093  Sum_probs=16.0

Q ss_pred             HHHHHHhhcCCCCCceee
Q 047174           59 CKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        59 ~R~vFeqfDeDsnGti~~   76 (80)
                      ++..|+++|.|.+|+|+.
T Consensus         1 l~~~F~~~D~d~DG~is~   18 (25)
T PF13202_consen    1 LKDAFQQFDTDGDGKISF   18 (25)
T ss_dssp             HHHHHHHHTTTSSSEEEH
T ss_pred             CHHHHHHHcCCCCCcCCH
Confidence            578999999999999974


No 4  
>PF13499 EF-hand_7:  EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E ....
Probab=95.08  E-value=0.021  Score=32.77  Aligned_cols=19  Identities=21%  Similarity=0.125  Sum_probs=14.1

Q ss_pred             HHHHHHHhhcCCCCCceee
Q 047174           58 NCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        58 ~~R~vFeqfDeDsnGti~~   76 (80)
                      +++.+|+.||.|.||.|+.
T Consensus         1 ~l~~~F~~~D~d~~G~i~~   19 (66)
T PF13499_consen    1 RLKEAFKKFDKDGDGYISK   19 (66)
T ss_dssp             HHHHHHHHHSTTSSSEEEH
T ss_pred             CHHHHHHHHcCCccCCCCH
Confidence            4677888888888887763


No 5  
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z. S100Z is a member of the S100 domain family within the EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100Z group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately.S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control. S100Z is normally expressed in various tissues, with its highest level of expression being in spleen and leukocytes. The function of S100Z remains unclear. Preliminary structural data suggests that S100Z is homodimer, however a heterodimer with S100P has been reported. S100Z is capable of binding calcium ions. When calcium binds to S110Z,  the protein experiences a conformational change, which exposes hydrophobic surfac
Probab=94.05  E-value=0.049  Score=34.68  Aligned_cols=25  Identities=8%  Similarity=0.141  Sum_probs=20.3

Q ss_pred             chHhHHHHHHHHHhhc-CCCCC-ceee
Q 047174           52 IDDSLRNCKAIFEKFG-GLQNP-LGVV   76 (80)
Q Consensus        52 ide~lr~~R~vFeqfD-eDsnG-ti~~   76 (80)
                      .-.++..++.+|.+|| .|+|| +|..
T Consensus         5 le~a~~~~~~~F~~~dd~dgdg~~Is~   31 (93)
T cd05026           5 LEGAMDTLIRIFHNYSGKEGDRYKLSK   31 (93)
T ss_pred             HHHHHHHHHHHHHHHHccCCCCCEECH
Confidence            3457888999999999 89998 6864


No 6  
>smart00054 EFh EF-hand, calcium binding motif. EF-hands are calcium-binding motifs that occur at least in pairs. Links between disease states and genes encoding EF-hands, particularly the S100 subclass, are emerging. Each motif consists of a 12 residue loop flanked on either side by a 12 residue alpha-helix. EF-hands undergo a conformational change unpon binding calcium ions.
Probab=93.96  E-value=0.062  Score=24.36  Aligned_cols=18  Identities=17%  Similarity=-0.027  Sum_probs=15.8

Q ss_pred             HHHHHHhhcCCCCCceee
Q 047174           59 CKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        59 ~R~vFeqfDeDsnGti~~   76 (80)
                      ++.+|+.||.|.+|.|..
T Consensus         2 ~~~~f~~~d~~~~g~i~~   19 (29)
T smart00054        2 LKEAFRLFDKDGDGKIDF   19 (29)
T ss_pred             HHHHHHHHCCCCCCcEeH
Confidence            678999999999998864


No 7  
>smart00027 EH Eps15 homology domain. Pair of EF hand motifs that recognise proteins containing Asn-Pro-Phe (NPF) sequences.
Probab=93.02  E-value=0.1  Score=32.71  Aligned_cols=25  Identities=12%  Similarity=0.072  Sum_probs=21.0

Q ss_pred             hHhHHHHHHHHHhhcCCCCCceeee
Q 047174           53 DDSLRNCKAIFEKFGGLQNPLGVVI   77 (80)
Q Consensus        53 de~lr~~R~vFeqfDeDsnGti~~~   77 (80)
                      .+-+..++.+|+.||.|.+|.|+.-
T Consensus         6 ~~~~~~l~~~F~~~D~d~~G~Is~~   30 (96)
T smart00027        6 PEDKAKYEQIFRSLDKNQDGTVTGA   30 (96)
T ss_pred             HHHHHHHHHHHHHhCCCCCCeEeHH
Confidence            3567889999999999999998753


No 8  
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13. S100A13 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A13 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100A13 is involved in the cellular export of interleukin-1 (IL-1) and of fibroblast growth factor-1 (FGF-1), which plays an important role in angiogenesis and tissue regeneration. Export is based on the CuII-dependent formation of multiprotein complexes containing the S100A13 protein. Assembly of these complexes occurs near the inner surface of the plasma membrane. Binding of two Ca(II) ions per monomer triggers key conformational changes leading to the creation of two identical and symmetrical Cu(II)-binding sites on the surface of the protein, close to the interface between the two monomers. These Cu
Probab=92.62  E-value=0.12  Score=33.46  Aligned_cols=24  Identities=8%  Similarity=-0.039  Sum_probs=20.4

Q ss_pred             hHhHHHHHHHHHhhcC-CCCCceee
Q 047174           53 DDSLRNCKAIFEKFGG-LQNPLGVV   76 (80)
Q Consensus        53 de~lr~~R~vFeqfDe-DsnGti~~   76 (80)
                      -.++..++.+|..||. |.+|+|..
T Consensus         4 E~ai~~l~~~F~~fd~~~~~g~i~~   28 (89)
T cd05022           4 EKAIETLVSNFHKASVKGGKESLTA   28 (89)
T ss_pred             HHHHHHHHHHHHHHhCCCCCCeECH
Confidence            4678899999999999 99998864


No 9  
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B. S100B is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100B group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100B is most abundant in glial cells of the central nervous system, predominately in astrocytes. S100B is involved in signal transduction via the inhibition of protein phoshorylation, regulation of enzyme activity and by affecting the calcium homeostasis. Upon calcium binding the S100B homodimer changes conformation to expose a hydrophobic cleft, which represents the interaction site of S100B with its more than 20 known target  proteins. These target proteins include several cellular architecture proteins such as tubulin and GFAP; S100B can inhibit polymerization of these oligomeric molecules. Furthermore, S100B i
Probab=92.08  E-value=0.15  Score=32.55  Aligned_cols=23  Identities=4%  Similarity=0.040  Sum_probs=19.5

Q ss_pred             HhHHHHHHHHHhhc-CCCCC-ceee
Q 047174           54 DSLRNCKAIFEKFG-GLQNP-LGVV   76 (80)
Q Consensus        54 e~lr~~R~vFeqfD-eDsnG-ti~~   76 (80)
                      .++-.++.+|..|| .|+|| .|+.
T Consensus         5 ~~~~~l~~aF~~fD~~dgdG~~I~~   29 (88)
T cd05027           5 KAMVALIDVFHQYSGREGDKHKLKK   29 (88)
T ss_pred             HHHHHHHHHHHHhcccCCCcCEECH
Confidence            56788999999998 89999 5864


No 10 
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1. S100A1 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A1 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. As is the case with many other members of S100 protein family, S100A1 is implicated in intracellular and extracellular regulatory activities, including interaction with myosin-associated twitchin kinase, actin-capping protein CapZ, sinapsin I, and tubulin. Structural data suggests that S100A1 proteins exist within cells as antiparallel homodimers, while heterodimers  with S100A4 and S100B also has been reported. Upon binding calcium S100A1 changes conformation to expose a hydrophobic cleft which is the interaction site of S100A1 with its more that 20 known target  proteins.
Probab=91.95  E-value=0.15  Score=31.66  Aligned_cols=25  Identities=4%  Similarity=0.060  Sum_probs=20.5

Q ss_pred             chHhHHHHHHHHHhhc-CCCCC-ceee
Q 047174           52 IDDSLRNCKAIFEKFG-GLQNP-LGVV   76 (80)
Q Consensus        52 ide~lr~~R~vFeqfD-eDsnG-ti~~   76 (80)
                      +..+...++.+|+.|| .|.+| .|+.
T Consensus         4 ~e~~~~~l~~~F~~fDd~dg~G~~Is~   30 (92)
T cd05025           4 LETAMETLINVFHAHSGKEGDKYKLSK   30 (92)
T ss_pred             HHHHHHHHHHHHHHHhcccCCCCeECH
Confidence            3467788999999997 99999 5864


No 11 
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10. S100A10 is a member of the S100 family of EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A1_like group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. A unique feature of S100A10 is that it contains mutation in both of the calcium binding sites, making it calcium insensitive. S100A10 has been detected in brain, heart, gastrointestinal tract, kidney, liver, lung, spleen, testes, epidermis, aorta, and thymus. Structural data supports the homo- and hetero-dimeric as well as hetero-tetrameric nature of the protein. S100A10 has multiple binding partners in its calcium free state and is therefore involved in many diverse biological functions.
Probab=91.66  E-value=0.17  Score=31.63  Aligned_cols=26  Identities=8%  Similarity=0.199  Sum_probs=21.4

Q ss_pred             cchHhHHHHHHHHHhhcC-CC-CCceee
Q 047174           51 KIDDSLRNCKAIFEKFGG-LQ-NPLGVV   76 (80)
Q Consensus        51 kide~lr~~R~vFeqfDe-Ds-nGti~~   76 (80)
                      .+-.++..++.+|..||. |. +|.|+.
T Consensus         2 ~~~~~~~~l~~~F~~~D~~dg~dG~Is~   29 (94)
T cd05031           2 ELEHAMESLILTFHRYAGKDGDKNTLSR   29 (94)
T ss_pred             hHHHHHHHHHHHHHHHhccCCCCCeECH
Confidence            345678899999999997 97 699875


No 12 
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms]
Probab=91.60  E-value=0.21  Score=33.44  Aligned_cols=24  Identities=17%  Similarity=0.169  Sum_probs=20.3

Q ss_pred             hHhHHHHHHHHHhhcCCCCCceee
Q 047174           53 DDSLRNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        53 de~lr~~R~vFeqfDeDsnGti~~   76 (80)
                      .+....++.+|+.||+|.+|.|..
T Consensus         4 ~~~~~el~~~F~~fD~d~~G~i~~   27 (151)
T KOG0027|consen    4 EEQILELKEAFQLFDKDGDGKISV   27 (151)
T ss_pred             HHHHHHHHHHHHHHCCCCCCcccH
Confidence            456788999999999999999853


No 13 
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif. Note that this S-100 hierarchy contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. Intracellularly, S100 proteins act as Ca-signaling or Ca-buffering proteins. The most unusual characteristic of certain S100 proteins is their occurrence in extracellular space, where they act in a cytokine-like manner through RAGE, the receptor for advanced glycation products. Structural data suggest that many S100 members exist within cells as homo- or heterodimers and even oligomers; oligomerization contributes to their functional diversification. Upon binding calcium, most S100 proteins change conformation to a more open structure exposing a hydrophobic cleft. This hydrophobic surface represents th
Probab=91.17  E-value=0.21  Score=30.46  Aligned_cols=25  Identities=12%  Similarity=0.286  Sum_probs=21.6

Q ss_pred             chHhHHHHHHHHHhhcC--CCCCceee
Q 047174           52 IDDSLRNCKAIFEKFGG--LQNPLGVV   76 (80)
Q Consensus        52 ide~lr~~R~vFeqfDe--DsnGti~~   76 (80)
                      ..+.++.++.+|..||.  |.+|.|+.
T Consensus         3 ~~~~~~~l~~~F~~~D~~~~~~G~Is~   29 (88)
T cd00213           3 LEKAIETIIDVFHKYSGKEGDKDTLSK   29 (88)
T ss_pred             HHHHHHHHHHHHHHHhhccCCCCcCcH
Confidence            35778899999999999  89999864


No 14 
>PF13499 EF-hand_7:  EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E ....
Probab=90.73  E-value=0.39  Score=27.39  Aligned_cols=22  Identities=18%  Similarity=0.036  Sum_probs=18.1

Q ss_pred             hHHHHHHHHHhhcCCCCCceee
Q 047174           55 SLRNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        55 ~lr~~R~vFeqfDeDsnGti~~   76 (80)
                      .-..+..+|+.+|.|.||.|..
T Consensus        38 ~~~~~~~~~~~~D~d~dG~i~~   59 (66)
T PF13499_consen   38 SDEMIDQIFREFDTDGDGRISF   59 (66)
T ss_dssp             HHHHHHHHHHHHTTTSSSSEEH
T ss_pred             HHHHHHHHHHHhCCCCcCCCcH
Confidence            3346788899999999999863


No 15 
>PTZ00183 centrin; Provisional
Probab=90.10  E-value=0.33  Score=30.97  Aligned_cols=24  Identities=13%  Similarity=0.104  Sum_probs=20.1

Q ss_pred             hHhHHHHHHHHHhhcCCCCCceee
Q 047174           53 DDSLRNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        53 de~lr~~R~vFeqfDeDsnGti~~   76 (80)
                      .+..+.+..+|.+||.|.||.|+.
T Consensus        13 ~~~~~~~~~~F~~~D~~~~G~i~~   36 (158)
T PTZ00183         13 EDQKKEIREAFDLFDTDGSGTIDP   36 (158)
T ss_pred             HHHHHHHHHHHHHhCCCCCCcccH
Confidence            356678999999999999999875


No 16 
>PF13833 EF-hand_8:  EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A ....
Probab=89.87  E-value=0.25  Score=27.58  Aligned_cols=23  Identities=13%  Similarity=0.063  Sum_probs=19.9

Q ss_pred             HhHHHHHHHHHhhcCCCCCceee
Q 047174           54 DSLRNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        54 e~lr~~R~vFeqfDeDsnGti~~   76 (80)
                      -+-..++.+|..||.|.||.|+.
T Consensus        22 ~s~~e~~~l~~~~D~~~~G~I~~   44 (54)
T PF13833_consen   22 LSEEEVDRLFREFDTDGDGYISF   44 (54)
T ss_dssp             SCHHHHHHHHHHHTTSSSSSEEH
T ss_pred             CCHHHHHHHHHhcccCCCCCCCH
Confidence            55567999999999999999974


No 17 
>PTZ00184 calmodulin; Provisional
Probab=89.46  E-value=0.5  Score=29.53  Aligned_cols=39  Identities=21%  Similarity=0.170  Sum_probs=24.9

Q ss_pred             CcccchhhhhhcCccchHhHHHHHHHHHhhcCCCCCcee
Q 047174           37 TALKSFNSIILKFPKIDDSLRNCKAIFEKFGGLQNPLGV   75 (80)
Q Consensus        37 ~s~KSfnSIiMkFPkide~lr~~R~vFeqfDeDsnGti~   75 (80)
                      -++..|=..+-.+.........++.+|+.||.|.+|.|+
T Consensus        64 i~~~ef~~~l~~~~~~~~~~~~~~~~F~~~D~~~~g~i~  102 (149)
T PTZ00184         64 IDFPEFLTLMARKMKDTDSEEEIKEAFKVFDRDGNGFIS  102 (149)
T ss_pred             CcHHHHHHHHHHhccCCcHHHHHHHHHHhhCCCCCCeEe
Confidence            444555444433333333446788999999999999876


No 18 
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms]
Probab=89.12  E-value=0.16  Score=39.12  Aligned_cols=26  Identities=8%  Similarity=0.103  Sum_probs=21.8

Q ss_pred             HhHHHHHHHHHhhcCCCCCceeeeee
Q 047174           54 DSLRNCKAIFEKFGGLQNPLGVVIAL   79 (80)
Q Consensus        54 e~lr~~R~vFeqfDeDsnGti~~~~~   79 (80)
                      ..+.+-|.||++||.|..|+|+.--|
T Consensus       121 ~~i~~Wr~vF~~~D~D~SG~I~~sEL  146 (221)
T KOG0037|consen  121 KYINQWRNVFRTYDRDRSGTIDSSEL  146 (221)
T ss_pred             HHHHHHHHHHHhcccCCCCcccHHHH
Confidence            46778899999999999999986433


No 19 
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6. S100A6 is a member of the S100 domain family within EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100A6 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control . S100A6 is normally expressed in the G1 phase of the cell cycle in neuronal cells. The function of S100A6 remains unclear, but evidence suggests that it is involved in cell cycle regulation and exocytosis. S100A6 may also be involved in tumorigenesis; the protein is overexpressed in several tumors. Ca2+ binding to S100A6 leads to a conformational change in the protein, which exposes a hydrophobic surface for interact
Probab=88.19  E-value=0.47  Score=30.25  Aligned_cols=25  Identities=24%  Similarity=0.294  Sum_probs=20.7

Q ss_pred             chHhHHHHHHHHHhhcC-CC-CCceee
Q 047174           52 IDDSLRNCKAIFEKFGG-LQ-NPLGVV   76 (80)
Q Consensus        52 ide~lr~~R~vFeqfDe-Ds-nGti~~   76 (80)
                      ..+++..+=++|.|||. |+ +|+|..
T Consensus         5 ~e~~~~~~i~~F~~y~~~~~~~g~Is~   31 (88)
T cd05029           5 LDQAIGLLVAIFHKYSGREGDKNTLSK   31 (88)
T ss_pred             HHHHHHHHHHHHHHHHccCCCCCEECH
Confidence            45788899999999998 77 788864


No 20 
>PTZ00184 calmodulin; Provisional
Probab=87.55  E-value=0.61  Score=29.10  Aligned_cols=24  Identities=13%  Similarity=0.158  Sum_probs=19.0

Q ss_pred             hHhHHHHHHHHHhhcCCCCCceee
Q 047174           53 DDSLRNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        53 de~lr~~R~vFeqfDeDsnGti~~   76 (80)
                      .+..+.++..|..+|.|.+|+|+.
T Consensus         7 ~~~~~~~~~~F~~~D~~~~G~i~~   30 (149)
T PTZ00184          7 EEQIAEFKEAFSLFDKDGDGTITT   30 (149)
T ss_pred             HHHHHHHHHHHHHHcCCCCCcCCH
Confidence            356678888899999988888764


No 21 
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.
Probab=87.19  E-value=0.51  Score=24.41  Aligned_cols=17  Identities=12%  Similarity=0.012  Sum_probs=11.0

Q ss_pred             HHHHHHhhcCCCCCcee
Q 047174           59 CKAIFEKFGGLQNPLGV   75 (80)
Q Consensus        59 ~R~vFeqfDeDsnGti~   75 (80)
                      ++.+|..||.|.+|.|+
T Consensus         2 ~~~~f~~~d~~~~g~l~   18 (63)
T cd00051           2 LREAFRLFDKDGDGTIS   18 (63)
T ss_pred             HHHHHHHhCCCCCCcCc
Confidence            45667777777666654


No 22 
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms]
Probab=87.14  E-value=0.26  Score=33.03  Aligned_cols=42  Identities=14%  Similarity=0.133  Sum_probs=29.3

Q ss_pred             CcccchhhhhhcCccchH----hHHHHHHHHHhhcCCCCCceeeee
Q 047174           37 TALKSFNSIILKFPKIDD----SLRNCKAIFEKFGGLQNPLGVVIA   78 (80)
Q Consensus        37 ~s~KSfnSIiMkFPkide----~lr~~R~vFeqfDeDsnGti~~~~   78 (80)
                      -++..|=++..+......    +-+.++.+|.-||.|.||.|..-.
T Consensus        61 I~~~eF~~l~~~~~~~~~~~~~~~~el~eaF~~fD~d~~G~Is~~e  106 (151)
T KOG0027|consen   61 IDFEEFLDLMEKLGEEKTDEEASSEELKEAFRVFDKDGDGFISASE  106 (151)
T ss_pred             EcHHHHHHHHHhhhcccccccccHHHHHHHHHHHccCCCCcCcHHH
Confidence            445555555555554444    455999999999999999997543


No 23 
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction. The alignment contains a pair of EF-hand motifs, typically one of them is canonical and binds to Ca2+, while the other may not bind to Ca2+. A hydrophobic binding pocket is formed by residues from both EF-hand motifs. The EH domain binds to proteins containing NPF (class I), [WF]W or SWG (class II), or H[TS]F (class III) sequence motifs.
Probab=85.16  E-value=0.57  Score=26.19  Aligned_cols=21  Identities=5%  Similarity=-0.232  Sum_probs=17.6

Q ss_pred             HHHHHHHHHhhcCCCCCceee
Q 047174           56 LRNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        56 lr~~R~vFeqfDeDsnGti~~   76 (80)
                      =..++.+|+.+|.|.+|.|+.
T Consensus        32 ~~~~~~i~~~~d~~~~g~i~~   52 (67)
T cd00052          32 RSVLAQIWDLADTDKDGKLDK   52 (67)
T ss_pred             HHHHHHHHHHhcCCCCCcCCH
Confidence            456899999999999998863


No 24 
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only]
Probab=84.49  E-value=0.65  Score=36.43  Aligned_cols=63  Identities=8%  Similarity=0.275  Sum_probs=39.7

Q ss_pred             CchhHHHHHHHHHHHHHhhc--CCc---ccchhhhhhcCccchH-hHHHHHHHHHhhcCCCCCceeeee
Q 047174           16 MPETKLEAKMVEAMQRRAAE--GTA---LKSFNSIILKFPKIDD-SLRNCKAIFEKFGGLQNPLGVVIA   78 (80)
Q Consensus        16 ~~e~kLe~KmvEam~~Ra~~--g~s---~KSfnSIiMkFPkide-~lr~~R~vFeqfDeDsnGti~~~~   78 (80)
                      +.+++|+..++--.-.-.+.  |..   --+++++--.||-|.. -.+..-.+|.|||+|-+|-||+--
T Consensus        52 s~~~el~~~l~rr~~ines~~~~~~~r~s~kv~n~yteF~eFsrkqIk~~~~~Fk~yDe~rDgfIdl~E  120 (244)
T KOG0041|consen   52 SADQELSANLIRRDDINESQGAGVPSRDSLKVFNVYTEFSEFSRKQIKDAESMFKQYDEDRDGFIDLME  120 (244)
T ss_pred             chHHHHHHHHHHHHHHhhccccCCcccccccccchhhhhhHHHHHHHHHHHHHHHHhcccccccccHHH
Confidence            55667777665431111112  211   1456667778887743 356667899999999999999753


No 25 
>PTZ00183 centrin; Provisional
Probab=83.79  E-value=0.76  Score=29.27  Aligned_cols=20  Identities=10%  Similarity=0.003  Sum_probs=15.1

Q ss_pred             HHHHHHHHhhcCCCCCceee
Q 047174           57 RNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        57 r~~R~vFeqfDeDsnGti~~   76 (80)
                      ..++.+|+.||.|.+|.|+.
T Consensus        90 ~~l~~~F~~~D~~~~G~i~~  109 (158)
T PTZ00183         90 EEILKAFRLFDDDKTGKISL  109 (158)
T ss_pred             HHHHHHHHHhCCCCCCcCcH
Confidence            56778888888888887753


No 26 
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13. S100A13 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A13 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100A13 is involved in the cellular export of interleukin-1 (IL-1) and of fibroblast growth factor-1 (FGF-1), which plays an important role in angiogenesis and tissue regeneration. Export is based on the CuII-dependent formation of multiprotein complexes containing the S100A13 protein. Assembly of these complexes occurs near the inner surface of the plasma membrane. Binding of two Ca(II) ions per monomer triggers key conformational changes leading to the creation of two identical and symmetrical Cu(II)-binding sites on the surface of the protein, close to the interface between the two monomers. These Cu
Probab=82.57  E-value=1.9  Score=27.86  Aligned_cols=51  Identities=12%  Similarity=0.283  Sum_probs=35.6

Q ss_pred             HHHHHHHHhh-cC---Ccccchhhhhhc-Cccc-hHhHHHHHHHHHhhcCCCCCceee
Q 047174           25 MVEAMQRRAA-EG---TALKSFNSIILK-FPKI-DDSLRNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        25 mvEam~~Ra~-~g---~s~KSfnSIiMk-FPki-de~lr~~R~vFeqfDeDsnGti~~   76 (80)
                      ++++.+.-.. .|   -+...+=.++.. +|.+ .+. ..|+.+|++.|.|++|.|+.
T Consensus        10 l~~~F~~fd~~~~~g~i~~~ELk~ll~~elg~~ls~~-~~v~~mi~~~D~d~DG~I~F   66 (89)
T cd05022          10 LVSNFHKASVKGGKESLTASEFQELLTQQLPHLLKDV-EGLEEKMKNLDVNQDSKLSF   66 (89)
T ss_pred             HHHHHHHHhCCCCCCeECHHHHHHHHHHHhhhhccCH-HHHHHHHHHhCCCCCCCCcH
Confidence            4555565555 34   345556667777 8754 222 67999999999999999974


No 27 
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms]
Probab=82.19  E-value=1.2  Score=33.08  Aligned_cols=38  Identities=21%  Similarity=0.295  Sum_probs=28.5

Q ss_pred             Ccccchhhhh-hcCccchHhHHHHHHHHHhhcCCCCCcee
Q 047174           37 TALKSFNSII-LKFPKIDDSLRNCKAIFEKFGGLQNPLGV   75 (80)
Q Consensus        37 ~s~KSfnSIi-MkFPkide~lr~~R~vFeqfDeDsnGti~   75 (80)
                      -+...|=.|. .-|| .-.+=.-+.-||+-||.|.||+|+
T Consensus        44 ~~~~~F~~i~~~~fp-~gd~~~y~~~vF~~fD~~~dg~i~   82 (193)
T KOG0044|consen   44 LTLEEFREIYASFFP-DGDASKYAELVFRTFDKNKDGTID   82 (193)
T ss_pred             cCHHHHHHHHHHHCC-CCCHHHHHHHHHHHhcccCCCCcC
Confidence            4555555554 3467 666667788999999999999998


No 28 
>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only]
Probab=82.07  E-value=0.98  Score=38.85  Aligned_cols=31  Identities=10%  Similarity=-0.109  Sum_probs=25.5

Q ss_pred             hcCccchH----hHHHHHHHHHhhcCCCCCceeee
Q 047174           47 LKFPKIDD----SLRNCKAIFEKFGGLQNPLGVVI   77 (80)
Q Consensus        47 MkFPkide----~lr~~R~vFeqfDeDsnGti~~~   77 (80)
                      ..+|-+-|    |++.||+|-.|.|.|.||+||+-
T Consensus        54 ~~~~c~s~~dklg~EAir~iHrqmDDD~nG~Id~~   88 (575)
T KOG4403|consen   54 DAPECKSEQDKLGYEAIRDIHRQMDDDHNGSIDVE   88 (575)
T ss_pred             CCchhhcccchhhHHHHHHHHHhcccccCCCcccc
Confidence            34554444    89999999999999999999973


No 29 
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1. S100A1 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A1 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. As is the case with many other members of S100 protein family, S100A1 is implicated in intracellular and extracellular regulatory activities, including interaction with myosin-associated twitchin kinase, actin-capping protein CapZ, sinapsin I, and tubulin. Structural data suggests that S100A1 proteins exist within cells as antiparallel homodimers, while heterodimers  with S100A4 and S100B also has been reported. Upon binding calcium S100A1 changes conformation to expose a hydrophobic cleft which is the interaction site of S100A1 with its more that 20 known target  proteins.
Probab=81.30  E-value=1.5  Score=27.24  Aligned_cols=21  Identities=5%  Similarity=-0.072  Sum_probs=18.3

Q ss_pred             HHHHHHHHHhhcCCCCCceee
Q 047174           56 LRNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        56 lr~~R~vFeqfDeDsnGti~~   76 (80)
                      -..++.+|+.+|.|.+|.|+.
T Consensus        51 ~~~v~~i~~~~D~d~~G~I~f   71 (92)
T cd05025          51 ADAVDKIMKELDENGDGEVDF   71 (92)
T ss_pred             HHHHHHHHHHHCCCCCCcCcH
Confidence            356999999999999999974


No 30 
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z. S100Z is a member of the S100 domain family within the EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100Z group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately.S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control. S100Z is normally expressed in various tissues, with its highest level of expression being in spleen and leukocytes. The function of S100Z remains unclear. Preliminary structural data suggests that S100Z is homodimer, however a heterodimer with S100P has been reported. S100Z is capable of binding calcium ions. When calcium binds to S110Z,  the protein experiences a conformational change, which exposes hydrophobic surfac
Probab=80.94  E-value=1.5  Score=27.84  Aligned_cols=58  Identities=12%  Similarity=0.163  Sum_probs=36.9

Q ss_pred             hHHHHHHHHH---HHHHh-hcCC----cccchhhhhhc-Ccc---chHhHHHHHHHHHhhcCCCCCceee
Q 047174           19 TKLEAKMVEA---MQRRA-AEGT----ALKSFNSIILK-FPK---IDDSLRNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        19 ~kLe~KmvEa---m~~Ra-~~g~----s~KSfnSIiMk-FPk---ide~lr~~R~vFeqfDeDsnGti~~   76 (80)
                      +.||+-|.++   .++-+ .-|.    +..-+=.++.+ +|.   -...-..+..+++++|.|.||.|+.
T Consensus         3 ~~le~a~~~~~~~F~~~dd~dgdg~~Is~~EL~~ll~~~~~~~~~~~~~~~~v~~i~~elD~n~dG~Idf   72 (93)
T cd05026           3 TQLEGAMDTLIRIFHNYSGKEGDRYKLSKGELKELLQRELTDFLSSQKDPMLVDKIMNDLDSNKDNEVDF   72 (93)
T ss_pred             cHHHHHHHHHHHHHHHHHccCCCCCEECHHHHHHHHHHHhHHhcccccCHHHHHHHHHHhCCCCCCCCCH
Confidence            5677766655   55665 2232    44455555544 442   2224457999999999999999974


No 31 
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11. S100A11 is a member of the S-100 domain family within EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100A11 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control . S100 proteins have also been associated with a variety of pathological events, including neoplastic transformation and neurodegenerative diseases such as Alzheimer's, usually via over expression of the protein. S100A11 is expressed in smooth muscle and other tissues and involves in calcium-dependent membrane aggregation, which is important for cell vesiculation . As is the case for many other S100 proteins, S
Probab=79.32  E-value=2.2  Score=27.30  Aligned_cols=26  Identities=15%  Similarity=0.193  Sum_probs=20.4

Q ss_pred             ccchHhHHHHHHHHHh-hcCCCCC-cee
Q 047174           50 PKIDDSLRNCKAIFEK-FGGLQNP-LGV   75 (80)
Q Consensus        50 Pkide~lr~~R~vFeq-fDeDsnG-ti~   75 (80)
                      +..-.++.++..+|.+ +|.|.+| +|.
T Consensus         2 ~~le~~i~~l~~~F~~y~~~dg~~~~Ls   29 (89)
T cd05023           2 TETERCIESLIAVFQKYAGKDGDSYQLS   29 (89)
T ss_pred             ChHHHHHHHHHHHHHHHhccCCCcCeEC
Confidence            3456788999999999 6787776 775


No 32 
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]
Probab=75.84  E-value=2.8  Score=30.48  Aligned_cols=30  Identities=20%  Similarity=0.372  Sum_probs=23.3

Q ss_pred             hhcCccch-HhHHHHHHHHHhhcCCCCCcee
Q 047174           46 ILKFPKID-DSLRNCKAIFEKFGGLQNPLGV   75 (80)
Q Consensus        46 iMkFPkid-e~lr~~R~vFeqfDeDsnGti~   75 (80)
                      .+.|-.|+ +-...++..|.-||+|++|.|+
T Consensus         8 ~~~~~~~t~~qi~~lkeaF~l~D~d~~G~I~   38 (160)
T COG5126           8 LLTFTQLTEEQIQELKEAFQLFDRDSDGLID   38 (160)
T ss_pred             hhhcccCCHHHHHHHHHHHHHhCcCCCCCCc
Confidence            33444444 4568999999999999999986


No 33 
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10. S100A10 is a member of the S100 family of EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A1_like group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. A unique feature of S100A10 is that it contains mutation in both of the calcium binding sites, making it calcium insensitive. S100A10 has been detected in brain, heart, gastrointestinal tract, kidney, liver, lung, spleen, testes, epidermis, aorta, and thymus. Structural data supports the homo- and hetero-dimeric as well as hetero-tetrameric nature of the protein. S100A10 has multiple binding partners in its calcium free state and is therefore involved in many diverse biological functions.
Probab=74.41  E-value=3  Score=25.96  Aligned_cols=53  Identities=9%  Similarity=0.150  Sum_probs=31.7

Q ss_pred             HHHHHHHHHhh-c---C-Ccccchhhhhhc-Ccc---chHhHHHHHHHHHhhcCCCCCceee
Q 047174           24 KMVEAMQRRAA-E---G-TALKSFNSIILK-FPK---IDDSLRNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        24 KmvEam~~Ra~-~---g-~s~KSfnSIiMk-FPk---ide~lr~~R~vFeqfDeDsnGti~~   76 (80)
                      .+.++.+.-.. .   | -+...+=.++.. +|.   +...-..+..+|+++|.|.+|.|+.
T Consensus         9 ~l~~~F~~~D~~dg~dG~Is~~El~~~l~~~~g~~lg~~~s~~ei~~~~~~~D~~~dg~I~f   70 (94)
T cd05031           9 SLILTFHRYAGKDGDKNTLSRKELKKLMEKELSEFLKNQKDPMAVDKIMKDLDQNRDGKVNF   70 (94)
T ss_pred             HHHHHHHHHhccCCCCCeECHHHHHHHHHHHhHHHhhccccHHHHHHHHHHhCCCCCCcCcH
Confidence            34555544443 2   3 344444444443 332   2334468999999999999999873


No 34 
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 . Note that the S-100 hierarchy, to which this Calgranulin group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. These proteins are expressed mainly in granulocytes, and are involved in inflammation, allergy, and neuritogenesis, as well as in host-parasite response. Calgranulins are modulated not only by calcium, but also by other metals such as zinc and copper. Structural data suggested that calgranulins may exist in  multiple structural forms, homodimers, as well as hetero-oligomers. For example, the S100A8/S100A9 complex called calprotectin plays important roles in the regulation of inflammatory processes, wound repair, and regulating zinc-dependent enzymes as well as microbial growth.
Probab=73.70  E-value=3  Score=26.15  Aligned_cols=21  Identities=19%  Similarity=0.150  Sum_probs=18.0

Q ss_pred             HHHHHHHHHhhcCCCCCceee
Q 047174           56 LRNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        56 lr~~R~vFeqfDeDsnGti~~   76 (80)
                      =..+..+|.++|.|.+|.|+.
T Consensus        50 ~~~v~~i~~~~D~d~dG~I~f   70 (88)
T cd05030          50 QKAIDKIFEDLDTNQDGQLSF   70 (88)
T ss_pred             HHHHHHHHHHcCCCCCCcCcH
Confidence            356889999999999999873


No 35 
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP). SPARC (BM-40) is a multifunctional glycoprotein, a matricellular protein, that functions to regulate cell-matrix interactions; binds to such proteins as collagen and vitronectin and binds to endothelial cells thus inhibiting cellular proliferation. The EC domain interacts with a follistatin-like (FS) domain which appears to stabilize Ca2+ binding. The two EF-hands interact canonically but their conserved disulfide bonds confer a tight association between the EF-hand pair and an acid/amphiphilic N-terminal helix. Proposed active form involves a Ca2+ dependent symmetric homodimerization of EC-FS modules.
Probab=73.01  E-value=3.2  Score=28.16  Aligned_cols=22  Identities=9%  Similarity=-0.026  Sum_probs=18.4

Q ss_pred             HhHHHHHHHHHhhcCCCCCcee
Q 047174           54 DSLRNCKAIFEKFGGLQNPLGV   75 (80)
Q Consensus        54 e~lr~~R~vFeqfDeDsnGti~   75 (80)
                      +--..++-.|.++|.|.||.|+
T Consensus        45 ~~~~~l~w~F~~lD~d~DG~Ls   66 (116)
T cd00252          45 MCKDPVGWMFNQLDGNYDGKLS   66 (116)
T ss_pred             HHHHHHHHHHHHHCCCCCCcCC
Confidence            3446678999999999999886


No 36 
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6. S100A6 is a member of the S100 domain family within EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100A6 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control . S100A6 is normally expressed in the G1 phase of the cell cycle in neuronal cells. The function of S100A6 remains unclear, but evidence suggests that it is involved in cell cycle regulation and exocytosis. S100A6 may also be involved in tumorigenesis; the protein is overexpressed in several tumors. Ca2+ binding to S100A6 leads to a conformational change in the protein, which exposes a hydrophobic surface for interact
Probab=70.95  E-value=4  Score=25.94  Aligned_cols=56  Identities=16%  Similarity=0.229  Sum_probs=34.4

Q ss_pred             hHHHHH---HHHHHHHHhh-cC----Ccccchhhhhhc----CccchHhHHHHHHHHHhhcCCCCCceee
Q 047174           19 TKLEAK---MVEAMQRRAA-EG----TALKSFNSIILK----FPKIDDSLRNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        19 ~kLe~K---mvEam~~Ra~-~g----~s~KSfnSIiMk----FPkide~lr~~R~vFeqfDeDsnGti~~   76 (80)
                      +.||+-   +|+..++.+. .|    -+..-|=.++.+    -.++  +-..+..+|++.|.|++|.|+.
T Consensus         3 ~~~e~~~~~~i~~F~~y~~~~~~~g~Is~~EL~~~l~~~~~lg~k~--t~~ev~~m~~~~D~d~dG~Idf   70 (88)
T cd05029           3 SPLDQAIGLLVAIFHKYSGREGDKNTLSKKELKELIQKELTIGSKL--QDAEIAKLMEDLDRNKDQEVNF   70 (88)
T ss_pred             cHHHHHHHHHHHHHHHHHccCCCCCEECHHHHHHHHHHHHhcCCCC--CHHHHHHHHHHhcCCCCCCCcH
Confidence            445554   4555666665 23    233334445532    2333  3368899999999999999974


No 37 
>smart00027 EH Eps15 homology domain. Pair of EF hand motifs that recognise proteins containing Asn-Pro-Phe (NPF) sequences.
Probab=70.57  E-value=10  Score=23.57  Aligned_cols=21  Identities=5%  Similarity=-0.344  Sum_probs=18.3

Q ss_pred             HHHHHHHHHhhcCCCCCceee
Q 047174           56 LRNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        56 lr~~R~vFeqfDeDsnGti~~   76 (80)
                      -..++.+|..+|.|.+|+|+.
T Consensus        43 ~~ev~~i~~~~d~~~~g~I~~   63 (96)
T smart00027       43 QTLLAKIWNLADIDNDGELDK   63 (96)
T ss_pred             HHHHHHHHHHhcCCCCCCcCH
Confidence            367899999999999999874


No 38 
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11. S100A11 is a member of the S-100 domain family within EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100A11 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control . S100 proteins have also been associated with a variety of pathological events, including neoplastic transformation and neurodegenerative diseases such as Alzheimer's, usually via over expression of the protein. S100A11 is expressed in smooth muscle and other tissues and involves in calcium-dependent membrane aggregation, which is important for cell vesiculation . As is the case for many other S100 proteins, S
Probab=66.55  E-value=5.3  Score=25.51  Aligned_cols=20  Identities=5%  Similarity=-0.157  Sum_probs=17.1

Q ss_pred             HHHHHHHHhhcCCCCCceee
Q 047174           57 RNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        57 r~~R~vFeqfDeDsnGti~~   76 (80)
                      ..+..+|+.+|.|+||.|+.
T Consensus        52 ~~~~~ll~~~D~d~DG~I~f   71 (89)
T cd05023          52 GVLDRMMKKLDLNSDGQLDF   71 (89)
T ss_pred             HHHHHHHHHcCCCCCCcCcH
Confidence            45778999999999999873


No 39 
>COG3382 Solo B3/4 domain (OB-fold DNA/RNA-binding) of Phe-aaRS-beta [General function prediction only]
Probab=60.53  E-value=6.2  Score=30.50  Aligned_cols=21  Identities=33%  Similarity=0.629  Sum_probs=19.3

Q ss_pred             HHHHHHHhhcCCcccchhhhh
Q 047174           26 VEAMQRRAAEGTALKSFNSII   46 (80)
Q Consensus        26 vEam~~Ra~~g~s~KSfnSIi   46 (80)
                      .|||++|...|.++-|+|+++
T Consensus        84 ~EALlrRv~kg~~lp~InpvV  104 (229)
T COG3382          84 AEALLRRVLKGNSLPRINPVV  104 (229)
T ss_pred             HHHHHHHHHcCCCccccchhh
Confidence            699999999999999998876


No 40 
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms]
Probab=60.07  E-value=4.3  Score=30.14  Aligned_cols=18  Identities=11%  Similarity=-0.084  Sum_probs=14.8

Q ss_pred             HHHHHHHhhcCCCCCcee
Q 047174           58 NCKAIFEKFGGLQNPLGV   75 (80)
Q Consensus        58 ~~R~vFeqfDeDsnGti~   75 (80)
                      +.+-.|+.||.|.||.|+
T Consensus       101 kl~w~F~lyD~dgdG~It  118 (193)
T KOG0044|consen  101 KLKWAFRLYDLDGDGYIT  118 (193)
T ss_pred             HhhhhheeecCCCCceEc
Confidence            344669999999999886


No 41 
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]
Probab=53.50  E-value=6.5  Score=28.56  Aligned_cols=25  Identities=12%  Similarity=0.093  Sum_probs=20.5

Q ss_pred             hHhHHHHHHHHHhhcCCCCCceeee
Q 047174           53 DDSLRNCKAIFEKFGGLQNPLGVVI   77 (80)
Q Consensus        53 de~lr~~R~vFeqfDeDsnGti~~~   77 (80)
                      .+.-+.++.-|+-||.|.+|.|.+-
T Consensus        88 ~~~~Eel~~aF~~fD~d~dG~Is~~  112 (160)
T COG5126          88 GDKEEELREAFKLFDKDHDGYISIG  112 (160)
T ss_pred             CCcHHHHHHHHHHhCCCCCceecHH
Confidence            3446788999999999999999753


No 42 
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional
Probab=52.04  E-value=14  Score=29.82  Aligned_cols=16  Identities=13%  Similarity=0.113  Sum_probs=7.5

Q ss_pred             HHHHHHhhcCCCCCce
Q 047174           59 CKAIFEKFGGLQNPLG   74 (80)
Q Consensus        59 ~R~vFeqfDeDsnGti   74 (80)
                      +..+|+++|.|.+|.|
T Consensus       359 ~~~~F~~~D~d~DG~I  374 (391)
T PRK12309        359 SDAVFDALDLNHDGKI  374 (391)
T ss_pred             HHHHHHHhCCCCCCCC
Confidence            3444444444444444


No 43 
>PF04367 DUF502:  Protein of unknown function (DUF502);  InterPro: IPR007462 This entry contains proteins that are predicted to be integral membrane proteins.
Probab=51.23  E-value=14  Score=24.23  Aligned_cols=37  Identities=16%  Similarity=0.306  Sum_probs=31.7

Q ss_pred             CcccchhhhhhcCccchHhHHHHHHHHHhhcCCCCCc
Q 047174           37 TALKSFNSIILKFPKIDDSLRNCKAIFEKFGGLQNPL   73 (80)
Q Consensus        37 ~s~KSfnSIiMkFPkide~lr~~R~vFeqfDeDsnGt   73 (80)
                      .-++-+|.++.|.|-++-=-..+|++.+.+..|+...
T Consensus        22 ~l~~~~e~ll~riP~v~~iY~~~k~~~~~~~~~~~~~   58 (108)
T PF04367_consen   22 WLLNWLERLLQRIPLVKSIYSSIKQLVESFSGDKKKS   58 (108)
T ss_pred             HHHHHHHHHHHHCCchHHHHHHHHHHHHHHhhccccc
Confidence            5567789999999999999999999999997777663


No 44 
>PF14788 EF-hand_10:  EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A ....
Probab=50.49  E-value=18  Score=22.20  Aligned_cols=24  Identities=13%  Similarity=0.065  Sum_probs=16.2

Q ss_pred             chHhHHHHHHHHHhhcCCCCCcee
Q 047174           52 IDDSLRNCKAIFEKFGGLQNPLGV   75 (80)
Q Consensus        52 ide~lr~~R~vFeqfDeDsnGti~   75 (80)
                      |+..=..++.+|++.|.+.+|+++
T Consensus        16 I~~~~~yA~~LFq~~D~s~~g~Le   39 (51)
T PF14788_consen   16 IEMDDEYARQLFQECDKSQSGRLE   39 (51)
T ss_dssp             ----HHHHHHHHHHH-SSSSSEBE
T ss_pred             cCcCHHHHHHHHHHhcccCCCCcc
Confidence            344445678899999999999876


No 45 
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms]
Probab=48.14  E-value=10  Score=33.26  Aligned_cols=39  Identities=21%  Similarity=0.221  Sum_probs=28.7

Q ss_pred             CcccchhhhhhcCccch-----------HhHHHHHHHHHhhcCCCCCceee
Q 047174           37 TALKSFNSIILKFPKID-----------DSLRNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        37 ~s~KSfnSIiMkFPkid-----------e~lr~~R~vFeqfDeDsnGti~~   76 (80)
                      +.=+..++-.+- |.|+           ++.+-+.++|++||.|.||..-+
T Consensus       285 ~DsleL~~~~l~-p~~~~~p~~s~ELs~~~~~Fl~~~f~~~D~d~Dg~L~p  334 (625)
T KOG1707|consen  285 TDSLELTDEYLP-PRLKVPPDQSVELSPKGYRFLVDVFEKFDRDNDGALSP  334 (625)
T ss_pred             cchhhhhhhhcC-ccccCCCCcceeccHHHHHHHHHHHHhccCCCCCCcCH
Confidence            444455554444 7764           68889999999999999997654


No 46 
>TIGR03296 M6dom_TIGR03296 M6 family metalloprotease domain. This model describes a metalloproteinase domain, with a characteristic HExxH motif. Examples of this domain are found in proteins in the family of immune inhibitor A, which cleaves antibacterial peptides, and in other, only distantly related proteases. This model is built to be broader and more inclusive than Pfam model pfam05547.
Probab=48.00  E-value=8.4  Score=29.07  Aligned_cols=15  Identities=7%  Similarity=-0.175  Sum_probs=13.7

Q ss_pred             HHHhhcCCCCCceee
Q 047174           62 IFEKFGGLQNPLGVV   76 (80)
Q Consensus        62 vFeqfDeDsnGti~~   76 (80)
                      -|.+||.|.||.||.
T Consensus        91 df~~yD~dgDG~vd~  105 (286)
T TIGR03296        91 DFDRYDLDGDGNFDE  105 (286)
T ss_pred             ccccccccCCCccCC
Confidence            578999999999998


No 47 
>PLN02964 phosphatidylserine decarboxylase
Probab=47.35  E-value=14  Score=31.98  Aligned_cols=39  Identities=10%  Similarity=0.136  Sum_probs=25.5

Q ss_pred             CcccchhhhhhcCccchHhHHHHHHHHHhhcCCCCCceee
Q 047174           37 TALKSFNSIILKFPKIDDSLRNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        37 ~s~KSfnSIiMkFPkide~lr~~R~vFeqfDeDsnGti~~   76 (80)
                      -++..|=+++..+.. ...-+.++.+|+.||.|.+|.|..
T Consensus       196 IdfdEFl~lL~~lg~-~~seEEL~eaFk~fDkDgdG~Is~  234 (644)
T PLN02964        196 LSFSEFSDLIKAFGN-LVAANKKEELFKAADLNGDGVVTI  234 (644)
T ss_pred             EcHHHHHHHHHHhcc-CCCHHHHHHHHHHhCCCCCCcCCH
Confidence            444445444454432 123456999999999999999864


No 48 
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional
Probab=45.79  E-value=20  Score=29.05  Aligned_cols=50  Identities=10%  Similarity=0.004  Sum_probs=31.4

Q ss_pred             HHHHHHHHHHhhcCCc----ccchhhhhhcCccchHhHHHHHHHHHhhcCCCCCcee
Q 047174           23 AKMVEAMQRRAAEGTA----LKSFNSIILKFPKIDDSLRNCKAIFEKFGGLQNPLGV   75 (80)
Q Consensus        23 ~KmvEam~~Ra~~g~s----~KSfnSIiMkFPkide~lr~~R~vFeqfDeDsnGti~   75 (80)
                      -|+.|.+|.-+.....    +++-=+-|-++|-+...   ++.+|.-||.|.||.|+
T Consensus       299 ekl~egi~~F~~d~~~L~~~i~~~~~~~~~~~~~~~~---l~~aF~~~D~dgdG~Is  352 (391)
T PRK12309        299 EKLDEGIKGFSKALETLEKLLAHRLARLEGGEAFTHA---AQEIFRLYDLDGDGFIT  352 (391)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhccChhhHH---HHHHHHHhCCCCCCcCc
Confidence            4556666655543322    22222346667777655   56689999999999884


No 49 
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism]
Probab=43.21  E-value=21  Score=30.44  Aligned_cols=28  Identities=4%  Similarity=0.016  Sum_probs=22.7

Q ss_pred             ccchHhHHHHHHHHHhhcCCCCCceeee
Q 047174           50 PKIDDSLRNCKAIFEKFGGLQNPLGVVI   77 (80)
Q Consensus        50 Pkide~lr~~R~vFeqfDeDsnGti~~~   77 (80)
                      +--.|.=..+|.+|+.||.+.||.+|+-
T Consensus         7 ~~~~er~~r~~~lf~~lD~~~~g~~d~~   34 (463)
T KOG0036|consen    7 ETDEERDIRIRCLFKELDSKNDGQVDLD   34 (463)
T ss_pred             CCcHHHHHHHHHHHHHhccCCCCceeHH
Confidence            3445566789999999999999999863


No 50 
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms]
Probab=43.03  E-value=18  Score=26.51  Aligned_cols=23  Identities=13%  Similarity=0.083  Sum_probs=17.6

Q ss_pred             HhHHH-HHHHHHhhcCCCCCceee
Q 047174           54 DSLRN-CKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        54 e~lr~-~R~vFeqfDeDsnGti~~   76 (80)
                      |.+.. +.-+|++||.|++|.|+.
T Consensus       143 e~~~~i~d~t~~e~D~d~DG~Isf  166 (187)
T KOG0034|consen  143 EQLEDIVDKTFEEADTDGDGKISF  166 (187)
T ss_pred             HHHHHHHHHHHHHhCCCCCCcCcH
Confidence            44433 567899999999999974


No 51 
>PF09631 Sen15:  Sen15 protein;  InterPro: IPR018593  The Sen15 subunit of the tRNA intron-splicing endonuclease is one of the two structural subunits of this heterotetrameric enzyme. Residues 36-157 of this subunit possess a novel homodimeric fold. Each monomer consists of three alpha-helices and a mixed antiparallel/parallel beta-sheet. Two monomers of Sen15 fold with two monomers of Sen34, one of the two catalytic subunits, to form an alpha2-beta2 tetramer as part of the functional endonuclease assembly []. ; PDB: 2GW6_B.
Probab=42.12  E-value=17  Score=23.59  Aligned_cols=13  Identities=23%  Similarity=0.514  Sum_probs=11.1

Q ss_pred             hHHHHHHHHHhhc
Q 047174           55 SLRNCKAIFEKFG   67 (80)
Q Consensus        55 ~lr~~R~vFeqfD   67 (80)
                      +|+.++.+|++..
T Consensus        54 s~~~i~~~f~~l~   66 (101)
T PF09631_consen   54 SLEQIDEVFDSLP   66 (101)
T ss_dssp             EHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHhc
Confidence            5889999999976


No 52 
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10. S100A10 is a member of the S100 family of EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A10 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. A unique feature of S100A10 is that it contains mutation in both of the calcium binding sites, making it calcium insensitive. S100A10 has been detected in brain, heart, gastrointestinal tract, kidney, liver, lung, spleen, testes, epidermis, aorta, and thymus. Structural data supports the homo- and hetero-dimeric as well as hetero-tetrameric nature of the protein. S100A10 has multiple binding partners in its calcium free state and is therefore involved in many diverse biological functions.
Probab=37.84  E-value=30  Score=23.01  Aligned_cols=19  Identities=5%  Similarity=-0.006  Sum_probs=16.7

Q ss_pred             HHHHHHHHhhcCCCCCcee
Q 047174           57 RNCKAIFEKFGGLQNPLGV   75 (80)
Q Consensus        57 r~~R~vFeqfDeDsnGti~   75 (80)
                      ..|..+|+.-|.|.+|.||
T Consensus        48 ~~vd~im~~LD~n~Dg~vd   66 (91)
T cd05024          48 MAVDKIMKDLDDCRDGKVG   66 (91)
T ss_pred             HHHHHHHHHhCCCCCCcCc
Confidence            3588899999999999987


No 53 
>PF10384 Scm3:  Centromere protein Scm3;  InterPro: IPR018465 The centromere protein Scm3 is a non-histone component of centromeric chromatin that binds to CenH3-H4 histones, which are required for kinetochore assembly. Scm3 is required for Cse4 localisation and is required for its centromeric association [, ]. The histone H3 variant Cse4 replaces conventional histone H3 in centromeric chromatin and helps direct the assembly of the kinetochore. In addition, Scm3 has been shown in Saccharomyces cerevisiae (Baker's yeast) to be required for G2/M progression []. Scm3 is required to maintain kinetochore function throughout the cell cycle. Scm3 contains a nuclear export signal (NES). The N-terminal region of Scm3 is well conserved and functions as the CenH3-interacting domain, while the C-terminal region is variable in size and sometimes consists of DNA binding motifs [].; GO: 0005634 nucleus; PDB: 3R45_C 2YFV_C 2L5A_A.
Probab=36.86  E-value=38  Score=20.98  Aligned_cols=20  Identities=35%  Similarity=0.439  Sum_probs=10.6

Q ss_pred             HHHHHhhcC-CCCCceeeeee
Q 047174           60 KAIFEKFGG-LQNPLGVVIAL   79 (80)
Q Consensus        60 R~vFeqfDe-DsnGti~~~~~   79 (80)
                      ..||++|.. |-.+..|.|-|
T Consensus        19 e~I~~KY~~~d~~~~~DeIDL   39 (58)
T PF10384_consen   19 ESIIEKYGQPDFEDQGDEIDL   39 (58)
T ss_dssp             HHHHHHHCSG-TCCSSEBCTT
T ss_pred             HHHHHHhcCcccCCccceeec
Confidence            456666655 55555555544


No 54 
>PLN02964 phosphatidylserine decarboxylase
Probab=35.37  E-value=35  Score=29.71  Aligned_cols=21  Identities=5%  Similarity=-0.048  Sum_probs=14.4

Q ss_pred             HhHHHHHHHHHhhcCCCCCce
Q 047174           54 DSLRNCKAIFEKFGGLQNPLG   74 (80)
Q Consensus        54 e~lr~~R~vFeqfDeDsnGti   74 (80)
                      .-++.++.+|+.||.|++|.|
T Consensus       140 kqi~elkeaF~lfD~dgdG~i  160 (644)
T PLN02964        140 QEPESACESFDLLDPSSSNKV  160 (644)
T ss_pred             HHHHHHHHHHHHHCCCCCCcC
Confidence            345667777777777777765


No 55 
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning]
Probab=35.35  E-value=39  Score=25.48  Aligned_cols=38  Identities=16%  Similarity=0.222  Sum_probs=28.7

Q ss_pred             Ccccchhhh-hhcCccchHhHHHHHHHHHhhcCCCCCcee
Q 047174           37 TALKSFNSI-ILKFPKIDDSLRNCKAIFEKFGGLQNPLGV   75 (80)
Q Consensus        37 ~s~KSfnSI-iMkFPkide~lr~~R~vFeqfDeDsnGti~   75 (80)
                      -++-+|... .-++-.=| ....|+..|.-||-|.+|.|-
T Consensus        86 i~fe~f~~~mt~k~~e~d-t~eEi~~afrl~D~D~~Gkis  124 (172)
T KOG0028|consen   86 ITFEDFRRVMTVKLGERD-TKEEIKKAFRLFDDDKTGKIS  124 (172)
T ss_pred             echHHHHHHHHHHHhccC-cHHHHHHHHHcccccCCCCcC
Confidence            455555544 45666666 889999999999999999874


No 56 
>PF10234 Cluap1:  Clusterin-associated protein-1;  InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin. Cluap1 expression is highest in the nucleus and gradually increases during late S to G2/M phases of the cell cycle and returns to the basal level in the G0/G1 phases. In addition, it is upregulated in colon cancer tissues compared to corresponding non-cancerous mucosa. It thus plays a crucial role in the life of the cell []. 
Probab=34.97  E-value=31  Score=27.02  Aligned_cols=44  Identities=25%  Similarity=0.360  Sum_probs=31.9

Q ss_pred             cCchhHHHHHHHHHHHHHhhcC-CcccchhhhhhcCccchHhHHHH----HHHHHhh
Q 047174           15 WMPETKLEAKMVEAMQRRAAEG-TALKSFNSIILKFPKIDDSLRNC----KAIFEKF   66 (80)
Q Consensus        15 ~~~e~kLe~KmvEam~~Ra~~g-~s~KSfnSIiMkFPkide~lr~~----R~vFeqf   66 (80)
                      ..+|+|+|+|=.|.  +|+... .+++|+-      |-|=+-++++    ...|++|
T Consensus       193 ~~Le~KIekkk~EL--ER~qKRL~sLq~vR------PAfmdEyEklE~EL~~lY~~Y  241 (267)
T PF10234_consen  193 ANLEAKIEKKKQEL--ERNQKRLQSLQSVR------PAFMDEYEKLEEELQKLYEIY  241 (267)
T ss_pred             HHHHHHHHHHHHHH--HHHHHHHHHHHhcC------hHHHHHHHHHHHHHHHHHHHH
Confidence            47899999999999  898877 7777775      6665655554    3445544


No 57 
>PF09422 WTX:  WTX protein;  InterPro: IPR019003  This entry contains proteins that have no known function.  The entry includes the WTX protein, which is an X chromosome gene; Wilms' tumor gene on the X chromosome (WTX) []. WTX protein is a protein encoded by a gene mutated in Wilms tumors and it forms a complex with beta-catenin, AXIN1 and beta-TrCP2 (beta-transducin repeat-containing protein 2) []. The WTX protein is found to be inactivated in one third of Wilms' tumours []. 
Probab=34.52  E-value=12  Score=31.79  Aligned_cols=22  Identities=36%  Similarity=0.536  Sum_probs=18.8

Q ss_pred             CcccchhhhhhcCccchHhHHHHHHHHHhhcCC
Q 047174           37 TALKSFNSIILKFPKIDDSLRNCKAIFEKFGGL   69 (80)
Q Consensus        37 ~s~KSfnSIiMkFPkide~lr~~R~vFeqfDeD   69 (80)
                      ++||||||++           -|=+||.--|+|
T Consensus       247 tSLKSFDSLT-----------GCGdIiAdqe~d  268 (471)
T PF09422_consen  247 TSLKSFDSLT-----------GCGDIIADQEDD  268 (471)
T ss_pred             Hhhhcccccc-----------ccchhccccchh
Confidence            8999999865           688999888887


No 58 
>PF07994 NAD_binding_5:  Myo-inositol-1-phosphate synthase;  InterPro: IPR002587 1L-myo-Inositol-1-phosphate synthase (5.5.1.4 from EC) catalyzes the conversion of D-glucose 6-phosphate to 1L-myo-inositol-1-phosphate, the first committed step in the production of all inositol-containing compounds, including phospholipids, either directly or by salvage. The enzyme exists in a cytoplasmic form in a wide range of plants, animals, and fungi. It has also been detected in several bacteria and a chloroplast form is observed in alga and higher plants. Inositol phosphates play an important role in signal transduction.  In Saccharomyces cerevisiae (Baker's yeast), the transcriptional regulation of the INO1 gene has been studied in detail [] and its expression is sensitive to the availability of phospholipid precursors as well as growth phase. The regulation of the structural gene encoding 1L-myo-inositol-1-phosphate synthase has also been analyzed at the transcriptional level in the aquatic angiosperm, Spirodela polyrrhiza (Giant duckweed) and the halophyte, Mesembryanthemum crystallinum (Common ice plant) [].; GO: 0004512 inositol-3-phosphate synthase activity, 0006021 inositol biosynthetic process, 0008654 phospholipid biosynthetic process; PDB: 1GR0_A 1P1K_B 1LA2_B 1RM0_B 1P1I_B 1JKF_A 1P1F_A 1P1J_B 1JKI_B 1P1H_A ....
Probab=34.24  E-value=19  Score=28.12  Aligned_cols=42  Identities=19%  Similarity=0.408  Sum_probs=28.0

Q ss_pred             HHHHHHHHHhhcCCcccchhhhhhcCccchHhHHHHHHHHHhhc
Q 047174           24 KMVEAMQRRAAEGTALKSFNSIILKFPKIDDSLRNCKAIFEKFG   67 (80)
Q Consensus        24 KmvEam~~Ra~~g~s~KSfnSIiMkFPkide~lr~~R~vFeqfD   67 (80)
                      ++++..++|--.|  +-++.|..||=|.-..+.....++|+||.
T Consensus       247 rl~~la~r~g~~G--v~~~ls~ffK~P~~~~g~~~~~~l~~q~~  288 (295)
T PF07994_consen  247 RLAKLALRRGMGG--VQEWLSFFFKSPMVPPGPPQEHDLFEQYE  288 (295)
T ss_dssp             HHHHHHHHTTS-E--EHHHHHHHBSS-T--TTSTT--HHHHHHH
T ss_pred             HHHHHHHHcCCCC--hhHHHHHHhcCCCccCCCCCCCcHHHHHH
Confidence            4455555554555  99999999999998888888888988884


No 59 
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton]
Probab=33.05  E-value=40  Score=25.03  Aligned_cols=24  Identities=17%  Similarity=0.079  Sum_probs=20.1

Q ss_pred             hHhHHHHHHHHHhhcCCCCCceee
Q 047174           53 DDSLRNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        53 de~lr~~R~vFeqfDeDsnGti~~   76 (80)
                      .+.+..+|++|.-||...+|-|+.
T Consensus         7 ~d~~~e~ke~F~lfD~~gD~ki~~   30 (152)
T KOG0030|consen    7 PDQMEEFKEAFLLFDRTGDGKISG   30 (152)
T ss_pred             cchHHHHHHHHHHHhccCcccccH
Confidence            355688999999999999998863


No 60 
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning]
Probab=32.89  E-value=28  Score=26.25  Aligned_cols=27  Identities=19%  Similarity=0.037  Sum_probs=22.4

Q ss_pred             cchHhHHHHHHHHHhhcCCCCCceeee
Q 047174           51 KIDDSLRNCKAIFEKFGGLQNPLGVVI   77 (80)
Q Consensus        51 kide~lr~~R~vFeqfDeDsnGti~~~   77 (80)
                      .--+.=++++..|+-||.|..|+||+-
T Consensus        27 l~~~q~q~i~e~f~lfd~~~~g~iD~~   53 (172)
T KOG0028|consen   27 LTEEQKQEIKEAFELFDPDMAGKIDVE   53 (172)
T ss_pred             ccHHHHhhHHHHHHhhccCCCCcccHH
Confidence            334555899999999999999999963


No 61 
>PF01023 S_100:  S-100/ICaBP type calcium binding domain;  InterPro: IPR013787 The calcium-binding domain found in S100 and CaBP-9k proteins is a subfamily of the EF-hand calcium-binding domain []. S100s are small dimeric acidic calcium and zinc-binding proteins abundant in the brain, with S100B playing an important role in modulating the proliferation and differentiation of neurons and glia cells []. S100 proteins have two different types of calcium-binding sites: a low affinity one with a special structure, and a 'normal' EF-hand type high-affinity site. Calbindin-D9k (CaBP-9k) also belong to this family of proteins, but it does not form dimers. CaBP-9k is a cytosolic protein expressed in a variety of tissues. Although its precise function is unknown, it appears to be under the control of the steroid hormones oestrogen and progesterone in the female reproductive system []. In the intestine, CaBP-9k may be involved in calcium absorption by mediating intracellular diffusion []. This entry represents a subdomain of the calcium-binding domain found in S100, CaBP-9k, and related proteins.; PDB: 2RGI_A 4DUQ_B 2KAY_B 2KAX_A 2CNP_A 1CNP_A 1A03_A 1JWD_B 2JTT_A 1XK4_B ....
Probab=30.31  E-value=69  Score=18.36  Aligned_cols=13  Identities=15%  Similarity=0.529  Sum_probs=11.3

Q ss_pred             HhHHHHHHHHHhh
Q 047174           54 DSLRNCKAIFEKF   66 (80)
Q Consensus        54 e~lr~~R~vFeqf   66 (80)
                      .++..+-.||.||
T Consensus         3 ~ai~~iI~vFhkY   15 (44)
T PF01023_consen    3 KAIETIIDVFHKY   15 (44)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHH
Confidence            5678889999999


No 62 
>cd06399 PB1_P40 The PB1 domain is essential part of the p40 adaptor protein which plays an important role in activating phagocyte NADPH oxidase during phagocytosis. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes , such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. The PB1 domain of p40 represents a type I PB1 domain which interacts with the PB1 domain of oxidase activator p67 w
Probab=29.51  E-value=34  Score=23.59  Aligned_cols=21  Identities=19%  Similarity=0.241  Sum_probs=18.7

Q ss_pred             hcCccchHhHHHHHHHHHhhc
Q 047174           47 LKFPKIDDSLRNCKAIFEKFG   67 (80)
Q Consensus        47 MkFPkide~lr~~R~vFeqfD   67 (80)
                      -.-|.|++-|.-+|.+|++.|
T Consensus        25 ~~~P~~kdLl~lmr~~f~~~d   45 (92)
T cd06399          25 SSTPLLKDLLELTRREFQRED   45 (92)
T ss_pred             ccCccHHHHHHHHHHHhchhh
Confidence            346999999999999999987


No 63 
>PF10923 DUF2791:  P-loop Domain of unknown function (DUF2791);  InterPro: IPR021228  This is a family of proteins found in archaea and bacteria. Some of the proteins in this family are annotated as being methyl-accepting chemotaxis proteins and ATP/GTP binding proteins. 
Probab=29.21  E-value=88  Score=25.80  Aligned_cols=46  Identities=17%  Similarity=0.358  Sum_probs=38.0

Q ss_pred             HHHHHHHHhhcC----CcccchhhhhhcCccchH-----hHHHHHHHHHhhcCCC
Q 047174           25 MVEAMQRRAAEG----TALKSFNSIILKFPKIDD-----SLRNCKAIFEKFGGLQ   70 (80)
Q Consensus        25 mvEam~~Ra~~g----~s~KSfnSIiMkFPkide-----~lr~~R~vFeqfDeDs   70 (80)
                      --+||++|-...    ..+.++.+.+.+++.|+.     -++++|+||.+.+...
T Consensus       302 sY~AL~~RL~~~~~~~~~~~n~~~pvIrL~~l~~eel~~l~~klr~i~a~~~~~~  356 (416)
T PF10923_consen  302 SYEALAQRLAEEFFADDGFDNLRAPVIRLQPLTPEELLELLEKLRDIYAEAYGYE  356 (416)
T ss_pred             ccHHHHHHHhccccccccccCccCceecCCCCCHHHHHHHHHHHHHHHHhhCCCC
Confidence            357899998643    578888999999999987     7899999999987654


No 64 
>smart00386 HAT HAT (Half-A-TPR) repeats. Present in several RNA-binding proteins. Structurally and sequentially thought to be similar to TPRs.
Probab=29.15  E-value=50  Score=15.29  Aligned_cols=11  Identities=18%  Similarity=0.588  Sum_probs=8.8

Q ss_pred             HHHHHHHHHhh
Q 047174           56 LRNCKAIFEKF   66 (80)
Q Consensus        56 lr~~R~vFeqf   66 (80)
                      .+.+|.||++.
T Consensus         3 ~~~~r~i~e~~   13 (33)
T smart00386        3 IERARKIYERA   13 (33)
T ss_pred             HHHHHHHHHHH
Confidence            56788999885


No 65 
>PF13767 DUF4168:  Domain of unknown function (DUF4168)
Probab=28.25  E-value=27  Score=21.55  Aligned_cols=38  Identities=24%  Similarity=0.348  Sum_probs=27.7

Q ss_pred             CCCCccccCchhHHHHHHHHHHHHHhhcCCcccchhhhhhc
Q 047174            8 PESTTSAWMPETKLEAKMVEAMQRRAAEGTALKSFNSIILK   48 (80)
Q Consensus         8 ~~s~~k~~~~e~kLe~KmvEam~~Ra~~g~s~KSfnSIiMk   48 (80)
                      |..|.+...+...-..+|++++   ...|=++-.||.|...
T Consensus        30 ~~~~~~~~~l~~~a~~~~~~~I---~~~GLtv~~fN~I~~~   67 (78)
T PF13767_consen   30 AEDPEEIQELQEEAQEEMVEAI---EENGLTVERFNEITQA   67 (78)
T ss_pred             ccCHHHHHHHHHHHHHHHHHHH---HHcCCCHHHHHHHHHH
Confidence            4444445566677788888886   5678889999999764


No 66 
>PF13174 TPR_6:  Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A.
Probab=28.09  E-value=22  Score=17.00  Aligned_cols=15  Identities=27%  Similarity=0.722  Sum_probs=11.0

Q ss_pred             CcccchhhhhhcCcc
Q 047174           37 TALKSFNSIILKFPK   51 (80)
Q Consensus        37 ~s~KSfnSIiMkFPk   51 (80)
                      ...+.|+.+|-+||.
T Consensus        18 ~A~~~~~~~~~~~P~   32 (33)
T PF13174_consen   18 EAIEYFQRLIKRYPD   32 (33)
T ss_dssp             HHHHHHHHHHHHSTT
T ss_pred             HHHHHHHHHHHHCcC
Confidence            566777788888774


No 67 
>PF08987 DUF1892:  Protein of unknown function (DUF1892);  InterPro: IPR015080 Proteins in this entry, which are synthesised by Saccharomycetes, adopt a structure consisting of a four-stranded beta-sheet, with strand order beta2-beta1-beta4-beta3, and two alpha-helices, with an overall topology of beta-beta-alpha-beta-beta-alpha. They have no known function []. ; PDB: 1N6Z_A.
Probab=28.08  E-value=40  Score=23.99  Aligned_cols=36  Identities=28%  Similarity=0.385  Sum_probs=23.8

Q ss_pred             chhhhhhcCccchHhHHHHHHHHHhhcC--------------CCCCceeeee
Q 047174           41 SFNSIILKFPKIDDSLRNCKAIFEKFGG--------------LQNPLGVVIA   78 (80)
Q Consensus        41 SfnSIiMkFPkide~lr~~R~vFeqfDe--------------DsnGti~~~~   78 (80)
                      =+|++|+-|  ==..|+.+-.-|++|||              -|+|-|++|.
T Consensus        38 fvDel~lpf--~v~~~d~lN~wFDkFDEeIciPNEGhIKYEI~SDGLVVlil   87 (115)
T PF08987_consen   38 FVDELILPF--QVDEFDELNEWFDKFDEEICIPNEGHIKYEIGSDGLVVLIL   87 (115)
T ss_dssp             EEEEEEE-----TT-HHHHHHHHHHHHHHHHTT--S-EEEEEETTTEEEEEE
T ss_pred             HHHhccccc--ccchHHHHHHHHHhhcceeecCCCCceEEEecCCcEEEEEE
Confidence            356655433  34578888899999987              3888888874


No 68 
>PF02184 HAT:  HAT (Half-A-TPR) repeat;  InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing. They are structurally and sequentially similar to TPRs (tetratricopeptide repeats), though they lack the highly conserved alanine and glycine residues found in TPRs. The number of HAT repeats found in different proteins varies between 9 and 12. HAT-repeat-containing proteins appear to be components of macromolecular complexes that are required for RNA processing []. The repeats may be involved in protein-protein interactions. The HAT motif has striking structural similarities to HEAT repeats (IPR000357 from INTERPRO), being of a similar length and consisting of two short helices connected by a loop domain, as in HEAT repeats.; GO: 0006396 RNA processing, 0005622 intracellular
Probab=27.56  E-value=50  Score=18.55  Aligned_cols=11  Identities=27%  Similarity=0.869  Sum_probs=9.6

Q ss_pred             HHHHHHHHHhh
Q 047174           56 LRNCKAIFEKF   66 (80)
Q Consensus        56 lr~~R~vFeqf   66 (80)
                      ++..|+|||+|
T Consensus         3 ~dRAR~IyeR~   13 (32)
T PF02184_consen    3 FDRARSIYERF   13 (32)
T ss_pred             HHHHHHHHHHH
Confidence            57789999998


No 69 
>PF03520 KCNQ_channel:  KCNQ voltage-gated potassium channel;  InterPro: IPR013821 Potassium channels are the most diverse group of the ion channel family [, ]. They are important in shaping the action potential, and in neuronal excitability and plasticity []. The potassium channel family is composed of several functionally distinct isoforms, which can be broadly separated into 2 groups []: the practically non-inactivating 'delayed' group and the rapidly inactivating 'transient' group. These are all highly similar proteins, with only small amino acid changes causing the diversity of the voltage-dependent gating mechanism, channel conductance and toxin binding properties. Each type of K+ channel is activated by different signals and conditions depending on their type of regulation: some open in response to depolarisation of the plasma membrane; others in response to hyperpolarisation or an increase in intracellular calcium concentration; some can be regulated by binding of a transmitter, together with intracellular kinases; while others are regulated by GTP-binding proteins or other second messengers []. In eukaryotic cells, K+ channels are involved in neural signalling and generation of the cardiac rhythm, act as effectors in signal transduction pathways involving G protein-coupled receptors (GPCRs) and may have a role in target cell lysis by cytotoxic T-lymphocytes []. In prokaryotic cells, they play a role in the maintenance of ionic homeostasis [].  All K+ channels discovered so far possess a core of alpha subunits, each comprising either one or two copies of a highly conserved pore loop domain (P-domain). The P-domain contains the sequence (T/SxxTxGxG), which has been termed the K+ selectivity sequence. In families that contain one P-domain, four subunits assemble to form a selective pathway for K+ across the membrane. However, it remains unclear how the 2 P-domain subunits assemble to form a selective pore. The functional diversity of these families can arise through homo- or hetero-associations of alpha subunits or association with auxiliary cytoplasmic beta subunits. K+ channel subunits containing one pore domain can be assigned into one of two superfamilies: those that possess six transmembrane (TM) domains and those that possess only two TM domains. The six TM domain superfamily can be further subdivided into conserved gene families: the voltage-gated (Kv) channels; the KCNQ channels (originally known as KvLQT channels); the EAG-like K+ channels; and three types of calcium (Ca)-activated K+ channels (BK, IK and SK) []. The 2TM domain family comprises inward-rectifying K+ channels. In addition, there are K+ channel alpha-subunits that possess two P-domains. These are usually highly regulated K+ selective leak channels. KCNQ channels (also known as KQT-like channels) differ from other voltage-gated 6 TM helix channels, chiefly in that they possess no tetramerisation domain. Consequently, they rely on interaction with accessory subunits, or form heterotetramers with other members of the family []. Currently, 5 members of the KCNQ family are known. These have been found to be widely distributed within the body, having been shown to be expressed in the heart, brain, pancreas, lung, placenta and ear. They were initially cloned as a result of a search for proteins involved in cardiac arhythmia. Subsequently, mutations in other KCNQ family members have been shown to be responsible for some forms of hereditary deafness [] and benign familial neonatal epilepsy []. This entry represents a region found at the C terminus of these proteins.; PDB: 3HFE_B 3HFC_C 3BJ4_B 2OVC_A.
Probab=27.37  E-value=21  Score=27.47  Aligned_cols=28  Identities=25%  Similarity=0.445  Sum_probs=0.0

Q ss_pred             hhcC----ccchHhHH--HHHHHHHhhcCCCCCceee
Q 047174           46 ILKF----PKIDDSLR--NCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        46 iMkF----Pkide~lr--~~R~vFeqfDeDsnGti~~   76 (80)
                      +|||    -||+|+||  +|++|-|||   |-|-.|+
T Consensus        79 ~~k~~varrkFkealrPYDVkDViEQY---SaGHldm  112 (202)
T PF03520_consen   79 KMKFFVARRKFKEALRPYDVKDVIEQY---SAGHLDM  112 (202)
T ss_dssp             -------------------------------------
T ss_pred             HHHHHHHHHHHHhhcCcccHHHHHHHH---hhhHHHH
Confidence            4565    58999998  799999999   4454443


No 70 
>PF10591 SPARC_Ca_bdg:  Secreted protein acidic and rich in cysteine Ca binding region;  InterPro: IPR019577  This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins. SPARC proteins are down-regulated in various tumours and may have a tumour-suppressor function [, ]. Testican-3 appears to be a novel regulator that reduces the activity of matrix metalloproteinase (MMP) in adult T-cell leukemia (ATL) []. This cysteine-rich domain is responsible for the anti-spreading activity of human urothelial cells. This extracellular calcium-binding domain is rich in alpha-helices and contains two EF-hands that each coordinates one Ca2+ ion, forming a helix-loop-helix structure that not only drives the conformation of the protein but is also necessary for biological activity. The anti-spreading activity was dependent on the coordination of Ca2+ by a Glu residue at the Z position of EF-hand 2 []. ; GO: 0005509 calcium ion binding, 0007165 signal transduction, 0005578 proteinaceous extracellular matrix; PDB: 1BMO_A 1SRA_A 2V53_A 1NUB_B.
Probab=27.23  E-value=33  Score=22.87  Aligned_cols=20  Identities=10%  Similarity=-0.071  Sum_probs=12.4

Q ss_pred             HHHHHHHHhhcCCCCCceee
Q 047174           57 RNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        57 r~~R~vFeqfDeDsnGti~~   76 (80)
                      .-+.=.|.|.|.|.||.++-
T Consensus        54 ~~~~W~F~~LD~n~d~~L~~   73 (113)
T PF10591_consen   54 RVVHWKFCQLDRNKDGVLDR   73 (113)
T ss_dssp             HHHHHHHHHH--T-SSEE-T
T ss_pred             hhhhhhHhhhcCCCCCccCH
Confidence            34566799999999998763


No 71 
>PF05465 Halo_GVPC:  Halobacterial gas vesicle protein C (GVPC) repeat;  InterPro: IPR008639 This family consists of Halobacterium gas vesicle protein C sequences which are thought to confer stability to the gas vesicle membranes [,].; GO: 0031412 gas vesicle organization, 0031411 gas vesicle
Probab=25.28  E-value=42  Score=18.53  Aligned_cols=18  Identities=11%  Similarity=0.455  Sum_probs=14.4

Q ss_pred             cchHhHHHHHHHHHhhcC
Q 047174           51 KIDDSLRNCKAIFEKFGG   68 (80)
Q Consensus        51 kide~lr~~R~vFeqfDe   68 (80)
                      -+.+.++..++.|+.|=+
T Consensus        10 ~~r~~f~~~~~aF~aY~~   27 (32)
T PF05465_consen   10 EFREEFDDTQDAFEAYAD   27 (32)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            456789999999999843


No 72 
>PF08338 DUF1731:  Domain of unknown function (DUF1731);  InterPro: IPR013549 This domain of unknown function appears towards the C terminus of proteins of the NAD dependent epimerase/dehydratase family (IPR001509 from INTERPRO) in bacteria, eukaryotes and archaea. Many of the proteins in which it is found are involved in cell-division inhibition. ; PDB: 3OH8_A.
Probab=24.89  E-value=37  Score=19.83  Aligned_cols=15  Identities=20%  Similarity=0.784  Sum_probs=9.1

Q ss_pred             hhhcCccchHhHHHH
Q 047174           45 IILKFPKIDDSLRNC   59 (80)
Q Consensus        45 IiMkFPkide~lr~~   59 (80)
                      ..-+||.++++|+++
T Consensus        33 F~F~~p~l~~AL~~l   47 (48)
T PF08338_consen   33 FQFRYPTLEEALRDL   47 (48)
T ss_dssp             ---S-SSHHHHHHH-
T ss_pred             CcccCCCHHHHHhcc
Confidence            456899999999875


No 73 
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton]
Probab=24.48  E-value=59  Score=24.55  Aligned_cols=20  Identities=10%  Similarity=-0.105  Sum_probs=17.7

Q ss_pred             HHHHHHHHhhcCCCCCceee
Q 047174           57 RNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        57 r~~R~vFeqfDeDsnGti~~   76 (80)
                      +.|+.-|.-||++..|+|+-
T Consensus       101 ~~I~~AF~~FD~~~~G~I~~  120 (171)
T KOG0031|consen  101 EVILNAFKTFDDEGSGKIDE  120 (171)
T ss_pred             HHHHHHHHhcCccCCCccCH
Confidence            57899999999999999974


No 74 
>PF09912 DUF2141:  Uncharacterized protein conserved in bacteria (DUF2141);  InterPro: IPR018673  This family of conserved hypothetical proteins has no known function. 
Probab=24.02  E-value=31  Score=22.89  Aligned_cols=11  Identities=9%  Similarity=-0.360  Sum_probs=9.2

Q ss_pred             hcCCCCCceee
Q 047174           66 FGGLQNPLGVV   76 (80)
Q Consensus        66 fDeDsnGti~~   76 (80)
                      +|+|.||..|.
T Consensus        61 hD~N~NgklD~   71 (112)
T PF09912_consen   61 HDENGNGKLDT   71 (112)
T ss_pred             EeCCCCCcCCc
Confidence            49999998874


No 75 
>PF11043 DUF2856:  Protein of unknown function (DUF2856);  InterPro: IPR020500 This phage protein modulates the activity of the host recBCD nuclease and thus protects the linear double stranded DNA from exonuclease degradation [].
Probab=23.78  E-value=55  Score=22.62  Aligned_cols=48  Identities=33%  Similarity=0.548  Sum_probs=31.9

Q ss_pred             CchhHHHHHHHHHH-----HHHhhcC-Ccccchh-hhhhcCccchHhHHHHHHHH
Q 047174           16 MPETKLEAKMVEAM-----QRRAAEG-TALKSFN-SIILKFPKIDDSLRNCKAIF   63 (80)
Q Consensus        16 ~~e~kLe~KmvEam-----~~Ra~~g-~s~KSfn-SIiMkFPkide~lr~~R~vF   63 (80)
                      .+|+|-|+..-.-+     |++...- ++++-|- ..+-+||.||-.|||-|.-|
T Consensus        37 ~~ETKaEr~~R~~I~LA~k~Ek~r~~~tsirp~rkat~~~f~eidprlrnyrsry   91 (97)
T PF11043_consen   37 PPETKAERMYRRDIQLAEKQEKERINQTSIRPFRKATYTKFPEIDPRLRNYRSRY   91 (97)
T ss_pred             ChhhHHHHHHHHHHHHHHHHHHHHHHHhhcchHHHhhhhcccccChHHHHHHHhh
Confidence            45677776543221     3333333 7777774 57789999999999999754


No 76 
>PF14424 Toxin-deaminase:  The  BURPS668_1122 family of deaminases
Probab=22.73  E-value=1.2e+02  Score=21.06  Aligned_cols=47  Identities=15%  Similarity=0.280  Sum_probs=30.4

Q ss_pred             hHHHHHHHHHHHHHhhcCCccc--chhhhhhcCccchHhHHHHHHHHHhhcCCC
Q 047174           19 TKLEAKMVEAMQRRAAEGTALK--SFNSIILKFPKIDDSLRNCKAIFEKFGGLQ   70 (80)
Q Consensus        19 ~kLe~KmvEam~~Ra~~g~s~K--SfnSIiMkFPkide~lr~~R~vFeqfDeDs   70 (80)
                      .+=|.||+|.+.+........+  +++=++..=|     -.-|..|++||=++=
T Consensus        74 ~DsE~KiL~~ia~~l~~~~~~~~G~i~l~te~~p-----C~SC~~vi~qF~~~~  122 (133)
T PF14424_consen   74 NDSEYKILEDIAKKLGDNPDPSGGTIDLFTELPP-----CESCSNVIEQFKKDF  122 (133)
T ss_pred             ccHHHHHHHHHHHHhccccccCCceEEEEecCCc-----ChhHHHHHHHHHHHC
Confidence            4558888888887775554433  5555555444     356888888886554


No 77 
>PF15386 Tantalus:  Drosophila Tantalus-like
Probab=22.72  E-value=32  Score=21.78  Aligned_cols=22  Identities=27%  Similarity=0.270  Sum_probs=18.6

Q ss_pred             HHHHHHHHhhcCCCCCceeeee
Q 047174           57 RNCKAIFEKFGGLQNPLGVVIA   78 (80)
Q Consensus        57 r~~R~vFeqfDeDsnGti~~~~   78 (80)
                      +++-.|||.=+.++||++..+.
T Consensus        36 ~~LETIfEEp~~~s~~~~~~~~   57 (61)
T PF15386_consen   36 KNLETIFEEPKNESNGCLVYMS   57 (61)
T ss_pred             CCcchhhccccccCCcceEEee
Confidence            4677899999999999998874


No 78 
>PF08706 D5_N:  D5 N terminal like;  InterPro: IPR014818 This domain is found in D5 proteins of DNA viruses and bacteriophage P4 DNA primase. 
Probab=21.58  E-value=71  Score=20.11  Aligned_cols=27  Identities=19%  Similarity=0.231  Sum_probs=17.0

Q ss_pred             cchHhHHHHHHH-----HHhhcCC------CCCceeee
Q 047174           51 KIDDSLRNCKAI-----FEKFGGL------QNPLGVVI   77 (80)
Q Consensus        51 kide~lr~~R~v-----FeqfDeD------snGti~~~   77 (80)
                      ++++-++.++..     .+.+|.|      .||++|+-
T Consensus        74 ~~~~i~~~~~~~~~~~~~~~~d~~~~~i~~~NGvldl~  111 (150)
T PF08706_consen   74 KIKEILKQLKSMPIAVPSDELDADPNLINFKNGVLDLR  111 (150)
T ss_pred             HHHHHHHHHHHhhhccChhhcCCCcCEEecCCEEEECC
Confidence            445556666544     5677877      67877753


No 79 
>cd01612 APG12_C Ubiquitin-like domain of APG12. APG12_C    The carboxy-terminal ubiquitin-like domain of APG12. Autophagy is a process in which cytoplasmic components are delivered to the lysosome/vacuole for degradation. Autophagy requires a ubiquitin-like protein conjugation system, in which APG12 is covalently bound to APG5.
Probab=21.19  E-value=74  Score=20.59  Aligned_cols=58  Identities=16%  Similarity=0.213  Sum_probs=33.3

Q ss_pred             CccccCchhHHHHHHHHHHHHHhhcC---CcccchhhhhhcCccchHhHHHHHHHHHhhcCCCCCcee
Q 047174           11 TTSAWMPETKLEAKMVEAMQRRAAEG---TALKSFNSIILKFPKIDDSLRNCKAIFEKFGGLQNPLGV   75 (80)
Q Consensus        11 ~~k~~~~e~kLe~KmvEam~~Ra~~g---~s~KSfnSIiMkFPkide~lr~~R~vFeqfDeDsnGti~   75 (80)
                      ++|+..+.+.-=...+..+|+|-.-.   +-+==+|..+  -|.-|+   .+.++|++||+  ||-..
T Consensus        17 k~kflv~~~~tv~~~~~~lrk~L~l~~~~slflyvnn~f--~p~~d~---~~g~LY~~~~~--dGfLy   77 (87)
T cd01612          17 QKVFKISATQSFQAVIDFLRKRLKLKASDSLFLYINNSF--APSPDE---NVGNLYRCFGT--NGELI   77 (87)
T ss_pred             ccEEEeCCCCCHHHHHHHHHHHhCCCccCeEEEEECCcc--CCCchh---HHHHHHHhcCC--CCEEE
Confidence            34555555555556677788887532   2222234422  366665   56778999965  56443


No 80 
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism]
Probab=20.91  E-value=1.1e+02  Score=25.89  Aligned_cols=29  Identities=21%  Similarity=0.232  Sum_probs=25.3

Q ss_pred             CCCCccccCchhHHHHHHHHHHHHHhhcCCc
Q 047174            8 PESTTSAWMPETKLEAKMVEAMQRRAAEGTA   38 (80)
Q Consensus         8 ~~s~~k~~~~e~kLe~KmvEam~~Ra~~g~s   38 (80)
                      ||+|..  -+|+-...++|++|++.|..|++
T Consensus       194 lDEPTS--GLDS~sA~~vv~~Lk~lA~~grt  222 (613)
T KOG0061|consen  194 LDEPTS--GLDSFSALQVVQLLKRLARSGRT  222 (613)
T ss_pred             ecCCCC--CcchhhHHHHHHHHHHHHhCCCE
Confidence            688855  59999999999999999998954


No 81 
>PF08181 DegQ:  DegQ (SacQ) family;  InterPro: IPR012554 This family consists of the DegQ (formerly sacQ) regulatory peptides. The DegQ family of peptides control the rates of synthesis of a class of both secreted and intracellular degradative enzymes in Bacillus subtilis. DegQ is 46 amino acids long and activates the synthesis of degradative enzymes. The expression of this peptide was shown to be subjected both to catabolite repression and DegS-DegU-mediated control. Thus allowing an increase in the rate of synthesis of degQ under conditions of nitrogen starvation [].
Probab=20.76  E-value=81  Score=19.28  Aligned_cols=16  Identities=31%  Similarity=0.547  Sum_probs=13.2

Q ss_pred             hHhHHHHHHHHHhhcC
Q 047174           53 DDSLRNCKAIFEKFGG   68 (80)
Q Consensus        53 de~lr~~R~vFeqfDe   68 (80)
                      .+||+||-.-.+|||+
T Consensus        24 t~sl~ninksidq~dk   39 (46)
T PF08181_consen   24 TDSLRNINKSIDQYDK   39 (46)
T ss_pred             HHHHHHHHHhHHHHhc
Confidence            4688888888899986


No 82 
>PF02171 Piwi:  Piwi domain;  InterPro: IPR003165 This domain is found in the stem cell self-renewal protein Piwi and its relatives in Drosophila melanogaster []. It has been found in the C-terminal of a number of proteins which also contain the PAZ domain (IPR003100 from INTERPRO) in their central region, for example the Argonaute proteins. Several of these proteins have been implicated in the development and maintenance of stem cells through the RNA-mediated gene-quelling mechanisms associated with the protein DICER. ; GO: 0005515 protein binding; PDB: 4F1N_B 3LUH_B 4EI1_A 3QX8_A 3LUC_C 3LUJ_B 3LUD_B 3QX9_A 3LUG_B 3LUK_B ....
Probab=20.40  E-value=2.5e+02  Score=20.36  Aligned_cols=59  Identities=22%  Similarity=0.280  Sum_probs=41.3

Q ss_pred             HHHHHHHHHHHHHhhcCCcccchhhhhh-c-------CccchH-hHHHHHHHHHhhcCCCCCceeeeee
Q 047174           20 KLEAKMVEAMQRRAAEGTALKSFNSIIL-K-------FPKIDD-SLRNCKAIFEKFGGLQNPLGVVIAL   79 (80)
Q Consensus        20 kLe~KmvEam~~Ra~~g~s~KSfnSIiM-k-------FPkide-~lr~~R~vFeqfDeDsnGti~~~~~   79 (80)
                      .|+.-+.+++++-...... .--..||. +       |+++.+ .++.++..|+++.++-+-.+.+|.+
T Consensus       127 ~l~~~~~~~L~~~~~~~~~-~~P~~IiiyRdGvse~~~~~v~~~Ei~~i~~a~~~~~~~~~p~~~~i~v  194 (302)
T PF02171_consen  127 NLEEIIKEALKEFKKNNGK-WLPERIIIYRDGVSEGQFKKVLEEEIEAIKEAIKELGEDYNPKITYIVV  194 (302)
T ss_dssp             HHHHHHHHHHHHHHHTTTT--TTSEEEEEEES--GGGHHHHHHHHHHHHHHHHHHHTHTTCTEEEEEEE
T ss_pred             chhhHHHHHHHHHHHHcCC-CCCceEEEEEcccCHHhhcccHHHHHHHHHHHHhhcccCCCCcEEEEEe
Confidence            4888889998875543322 12335554 2       566766 8999999999999888877777654


Done!