BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 047188
         (271 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4HE8|H Chain H, Crystal Structure Of The Membrane Domain Of Respiratory
           Complex I From Thermus Thermophilus
 pdb|4HE8|C Chain C, Crystal Structure Of The Membrane Domain Of Respiratory
           Complex I From Thermus Thermophilus
 pdb|4HEA|H Chain H, Crystal Structure Of The Entire Respiratory Complex I From
           Thermus Thermophilus
 pdb|4HEA|Q Chain Q, Crystal Structure Of The Entire Respiratory Complex I From
           Thermus Thermophilus
          Length = 365

 Score = 27.3 bits (59), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (53%)

Query: 171 YVLWYRPLYRAMRTDSALKFSWFFLFYLIHIGFCIFAAI 209
           + +W R  +  +R D  L+F W FLF L  + F + A +
Sbjct: 289 FFIWIRATWFRLRYDQLLRFGWGFLFPLALLWFLVTALV 327


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.143    0.462 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,190,968
Number of Sequences: 62578
Number of extensions: 315235
Number of successful extensions: 579
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 577
Number of HSP's gapped (non-prelim): 2
length of query: 271
length of database: 14,973,337
effective HSP length: 97
effective length of query: 174
effective length of database: 8,903,271
effective search space: 1549169154
effective search space used: 1549169154
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)