Citrus Sinensis ID: 047195


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------56
SCTNCGHIPVPYPLSTGPGCGDQSYKVRCNAGMLWFDGLNGSSYMITSINPLSQSLIIRPPGLIKNKCIAADYHGQGLQLDNNLRFNISSSNTVMVMNCSIEMLQKPFNCSSTSICHSYIRDNPVAKRTGGSINEYRIRVRAERCAAYQSFVDLDLSLPVSKWPEPGVKIEWALPREPTCKLPVDCQDLLNSMCLQDAESAGQKRCLYKAGFQWDPISGICKSLKCSHGKGCKHKKPKTAVIGVLATIKFYKHFHQSNREVSLTKVQKDISGANNSGRLARIFSSREITEATNNFSTGNLLGSGGFGEVFKAILDDETITAVKRAKLGNTKGIDPILNEVRILCQLNHRSLFMSMSPNGTLFDRLHRVQSGNWPPLKWHHRLHIARQTAQAIAYLHLLATPPIYHRDIKSSNILLDEKLDAKISDFGLSRLALNGASHVTTFAQGTLGYLDPEYYINFQLTDKSDVYSFGVVLVELLTSKKAVDFNREEEDVNLVVYFGNILKQERLVDAIDPMLKEGASEIELDSMKAFGLLGAACLDERRQNRPSIKEVADEIERII
cccccccccccccccccccccccccEEEEccccccccccccccEEEEEECccccEEEEcccccccccccccccccccccccccccEEECcccEEEEEccccccccccccccccccCEcccccccccccccccccccEEEEEccccEEEEEEccccccccccccccccEEEEEEccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccEEHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccccEEEEcHHHHHHHHcccccccccccccccEEEEEEEccccEEEEEEccccccccHHHHHHHHHHHHHccccccEEEEcccccHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEcccccccccccccccEEEECcccccccccHHHHcccccccccccccHHHHHHHHHccccccccccccccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHc
SCTNCGHIPVPYPLSTGPGCGDQSYKVRCNAGMLWFDGLNGSSYMITSINPLSQSLIIRPPGLIKNKCIAADYHGQGLQLDNNLRFNISSSNTVMVMNCSIEMLQKPFNCSSTSICHSYIRDNPVAKRTGGSINEYRIRVRAERCAAYQSFVDLDLSLPVSKWPEPGVKIEWALPREPTCKLPVDCQDLLNSMCLQDAESAGQKRCLYKAGFQWDPISGICKSLKCSHGKGCKHKKPKTAVIGVLATIKFYKHFHQSNREVSLT**************LARIFSSREITEATNNFSTGNLLGSGGFGEVFKAILDDETITAVKRAKLGNTKGIDPILNEVRILCQLNHRSLFMSMSPNGTLFDRLHRVQSGNWPPLKWHHRLHIARQTAQAIAYLHLLATPPIYHRDIKSSNILLDEKLDAKISDFGLSRLALNGASHVTTFAQGTLGYLDPEYYINFQLTDKSDVYSFGVVLVELLTSKKAVDFNREEEDVNLVVYFGNILKQERLVDAIDPMLKEGASEIELDSMKAFGLLGAACLDERRQNRPSIKEVADEIERII
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SCTNCGHIPVPYPLSTGPGCGDQSYKVRCNAGMLWFDGLNGSSYMITSINPLSQSLIIRPPGLIKNKCIAADYHGQGLQLDNNLRFNISSSNTVMVMNCSIEMLQKPFNCSSTSICHSYIRDNPVAKRTGGSINEYRIRVRAERCAAYQSFVDLDLSLPVSKWPEPGVKIEWALPREPTCKLPVDCQDLLNSMCLQDAESAGQKRCLYKAGFQWDPISGICKSLKCSHGKGCKHKKPKTAVIGVLATIKFYKHFHQSNREVSLTKVQKDISGANNSGRLARIFSSREITEATNNFSTGNLLGSGGFGEVFKAILDDETITAVKRAKLGNTKGIDPILNEVRILCQLNHRSLFMSMSPNGTLFDRLHRVQSGNWPPLKWHHRLHIARQTAQAIAYLHLLATPPIYHRDIKSSNILLDEKLDAKISDFGLSRLALNGASHVTTFAQGTLGYLDPEYYINFQLTDKSDVYSFGVVLVELLTSKKAVDFNREEEDVNLVVYFGNILKQERLVDAIDPMLKEGASEIELDSMKAFGLLGAACLDERRQNRPSIKEVADEIERII

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Wall-associated receptor kinase-like 20 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.probableQ9LZM4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QD2, chain B
Confidence level:very confident
Coverage over the Query: 292-505,518-553
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 280-557
View the alignment between query and template
View the model in PyMOL
Template: 3G0E, chain A
Confidence level:probable
Coverage over the Query: 251-478,498-559
View the alignment between query and template
View the model in PyMOL
Template: 3PVU, chain A
Confidence level:probable
Coverage over the Query: 194-478
View the alignment between query and template
View the model in PyMOL