Citrus Sinensis ID: 047201


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770--
MWLIAAVLHASNFLPLPCHLACPYNLYFSLFSFCLSFHPYYLNIFQENNNLLFFVIVLYFTLQHRGGRSHRRGFSDRPFNGANGRFVSGDSHISSVSNSNRGVRQGNYTAVPPAPFYQNQPFRQPPPYNQNQQFRPPPLYNRNPQFRRPRPPFDQNQAVQSRPRPRPPKPLDYRNWEHSKASLPPYSERFVVLSYNILADYLALSHRSKLYFHIPRHLLDWEWRKRSILFELGLWSADIMCFQEVDRFQDLEVELKFRGYTGIWKMRTGNAIDGCAIFWRASRFKLLYEEGIEFNKLGLRDNVAQICVLELLSQNFTENSAALPTSSAHSKKVAICNIHVLFNPKRGEIKLGQVRTLLEKAHAVSKTWNDAPVVLCGDFNCTPKSPLYNFILEQKLDLSGVDRDKVSGQASAEIREPPPPHSRVQSDGSTQGPPEAGISVSDPPSDNLEHDKDGNAEILNSTNSSSRSQCTDTVLGVSDKASSHMHCANKDSATSDEVTKESRQTMIDDSEVAVSGNGDKASNEHSDSNENTESVNHSTASLGNDCPSSVYQKKGSSSTLHQVEASSTATSIDFVLADKLENLSLGNLDETKAESESIREDGNAFLFALHSTEDSSQSNFDHYAQSNLDPNSEELGDELIDDLSPALDSEAVNAEETTYNPSLWTPMEIATATGNADCTYLEHPLQLRSTYAEVEDCTGTRDSHGEPLVTSYNRRFKGTVDYILRSEGLQTVRVLAPIPKHAMQWTPGYPTKKWGSDHIALASEVAFVETIK
ccHHHHHHHcccccccccccccccccHHHHHHHcccccccHHHHHcccccEEEEEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccEEEEEEcHHccccccccccccccccccccccHHHHHHHHHHHHHcccccccHHccccHHHHHHHHHHccccEEEEEcccccccccEEEEEcccccEEEEEEEEEcccccccccHHHHHHHHHHHccccccccccccccccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccEEEccccccccEEEEEEcccccEEEccccccHHHHcccccccccccccccHHHccEEEEEEccc
*WLIAAVLHASNFLPLPCHLACPYNLYFSLFSFCLSFHPYYLNIFQENNNLLFFVIVLYFTLQHR*********************************************************************************************************LDY***********PYSERFVVLSYNILADYLALSHRSKLYFHIPRHLLDWEWRKRSILFELGLWSADIMCFQEVDRFQDLEVELKFRGYTGIWKMRTGNAIDGCAIFWRASRFKLLYEEGIEFNKLGLRDNVAQICVLELLSQNFTEN*********HSKKVAICNIHVLFNPKRGEIKLGQVRTLLEKAHAVSKTWNDAPVVLCGDFNCTPKSPLYNFILEQKLDLSGVDR********************VQS**STQGPPEAGISVSDPPSDNLEHDKDGNAEILN*************VLGVSDKASSHMHCANKDSATS****KE**QTMIDDSEV******************************************************STA**ID***ADKL*******************EDGNAFLFALHSTEDSSQSNFD************************************TYNPSLWTPMEIATATGNADCTYLEHPLQLRSTYAEVEDCTGTRDSHGEPLVTSYNRRFKGTVDYILRSEGLQTVRVLAPIPKHAMQWTPGYPTKKWGSDHIALASEVAFVET**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWLIAAVLHASNFLPLPCHLACPYNLYFSLFSFCLSFHPYYLNIFQENNNLLFFVIVLYFTLQHRGGRSHRRGFSDRPFNGANGRFVSGDSHISSVSNSNRGVRQGNYTAVPPAPFYQNQPFRQPPPYNQNQQFRPPPLYNRNPQFRRPRPPFDQNQAVQSRPRPRPPKPLDYRNWEHSKASLPPYSERFVVLSYNILADYLALSHRSKLYFHIPRHLLDWEWRKRSILFELGLWSADIMCFQEVDRFQDLEVELKFRGYTGIWKMRTGNAIDGCAIFWRASRFKLLYEEGIEFNKLGLRDNVAQICVLELLSQNFTENSAALPTSSAHSKKVAICNIHVLFNPKRGEIKLGQVRTLLEKAHAVSKTWNDAPVVLCGDFNCTPKSPLYNFILEQKLDLSGVDRDKVSGQASAEIREPPPPHSRVQSDGSTQGPPEAGISVSDPPSDNLEHDKDGNAEILNSTNSSSRSQCTDTVLGVSDKASSHMHCANKDSATSDEVTKESRQTMIDDSEVAVSGNGDKASNEHSDSNENTESVNHSTASLGNDCPSSVYQKKGSSSTLHQVEASSTATSIDFVLADKLENLSLGNLDETKAESESIREDGNAFLFALHSTEDSSQSNFDHYAQSNLDPNSEELGDELIDDLSPALDSEAVNAEETTYNPSLWTPMEIATATGNADCTYLEHPLQLRSTYAEVEDCTGTRDSHGEPLVTSYNRRFKGTVDYILRSEGLQTVRVLAPIPKHAMQWTPGYPTKKWGSDHIALASEVAFVETIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Carbon catabolite repressor protein 4 homolog 6 Acts as catalytic component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover.probableQ8VYU4

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.13.-Exoribonucleases producing 5'-phosphomonoesters.probable
3.1.13.4Poly(A)-specific ribonuclease.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NGQ, chain A
Confidence level:very confident
Coverage over the Query: 172-316,330-397
View the alignment between query and template
View the model in PyMOL
Template: 1ZWX, chain A
Confidence level:confident
Coverage over the Query: 712-766
View the alignment between query and template
View the model in PyMOL
Template: 1VYB, chain A
Confidence level:probable
Coverage over the Query: 686-736,753-766
View the alignment between query and template
View the model in PyMOL