BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 047246
(252 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|A7ZFY6|RL17_CAMC1 50S ribosomal protein L17 OS=Campylobacter concisus (strain 13826)
GN=rplQ PE=3 SV=2
Length = 118
Score = 31.6 bits (70), Expect = 5.2, Method: Compositional matrix adjust.
Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
Query: 104 LSIVKDEGLEISQPALDPFKSEVHHLIT-ARRRNSKAHRRIY 144
++I+K E +E + P +S V LIT AR+ +S AHR ++
Sbjct: 26 IAIIKSEKIETTLPKAKELRSYVEKLITRARKGDSNAHRAVF 67
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.326 0.138 0.449
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 93,798,185
Number of Sequences: 539616
Number of extensions: 3708000
Number of successful extensions: 9351
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 9351
Number of HSP's gapped (non-prelim): 4
length of query: 252
length of database: 191,569,459
effective HSP length: 115
effective length of query: 137
effective length of database: 129,513,619
effective search space: 17743365803
effective search space used: 17743365803
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 60 (27.7 bits)