BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 047258
         (172 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q9SJF3|DCP1_ARATH mRNA-decapping enzyme-like protein OS=Arabidopsis thaliana
           GN=At1g08370 PE=1 SV=2
          Length = 367

 Score = 66.2 bits (160), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 46/66 (69%), Gaps = 2/66 (3%)

Query: 1   KVKSPSIRFEELEALLTMAVMDGPLESTPSNAADVPEDPAFVNFFSITMTVGNSSNVAIC 60
           K  S    FEELEA  TMAVMDGPLE + S A D P+DPAFVNFFS TM +GN+++ +  
Sbjct: 145 KASSSKSEFEELEAKPTMAVMDGPLEPS-STARDAPDDPAFVNFFSSTMNLGNTASGS-A 202

Query: 61  VQPYQS 66
             PYQS
Sbjct: 203 SGPYQS 208


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.310    0.128    0.382 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 73,911,661
Number of Sequences: 539616
Number of extensions: 3507372
Number of successful extensions: 27227
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 335
Number of HSP's successfully gapped in prelim test: 1509
Number of HSP's that attempted gapping in prelim test: 17346
Number of HSP's gapped (non-prelim): 7139
length of query: 172
length of database: 191,569,459
effective HSP length: 109
effective length of query: 63
effective length of database: 132,751,315
effective search space: 8363332845
effective search space used: 8363332845
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 57 (26.6 bits)