Citrus Sinensis ID: 047290

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--

MGNDEEEQGIKLFGKTITLHGRQVKEEQNQRGSDQPQAVVDKRPDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKTKPPGRGLPDGCLYDVASGDHHHQLLHHQLDQFDLEGVFVEDWHPAAAAHGYGGFQNAFPVKRRRSNSGGQLC

cccccHHccccccccccccccccccHHHccccccccccccccccccccccccccccccccEEEcccccccccHHcccccccccccccCCccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCECcccccccc

**************KTI****************************KIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVG*****************************************GVFVEDWHPAAAAHGYGGFQNAF**************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGNDEEEQGIKLFGKTITLHGRQVKEEQNQRGSDQPQAVVDKRPDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKTKPPGRGLPDGCLYDVASGDHHHQLLHHQLDQFDLEGVFVEDWHPAAAAHGYGGFQNAFPVKRRRSNSGGQLC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Dof zinc finger protein DOF1.5	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation.	probable	P68350

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QYP, chain A
Confidence level:probable
Coverage over the Query: 44-84
View the alignment between query and template
View the model in PyMOL