BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 047369
         (225 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1A98|A Chain A, Xprtase From E. Coli Complexed With Gmp
 pdb|1A98|B Chain B, Xprtase From E. Coli Complexed With Gmp
          Length = 152

 Score = 35.0 bits (79), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 4/62 (6%)

Query: 160 GPVMKRH-GITNLSRVLIFFYDHQN--ELKRLKQALKVGFRHLVFEDNYDTGTGDHYSLR 216
           G ++ R  GI ++  V I  YDH N  ELK LK+A   G   +V +D  DTG G   ++R
Sbjct: 43  GALLARELGIRHVDTVAISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTG-GTAVAIR 101

Query: 217 QL 218
           ++
Sbjct: 102 EM 103


>pdb|1A97|A Chain A, Xprtase From E. Coli Complexed With Gmp
 pdb|1A97|B Chain B, Xprtase From E. Coli Complexed With Gmp
 pdb|1A97|C Chain C, Xprtase From E. Coli Complexed With Gmp
 pdb|1A97|D Chain D, Xprtase From E. Coli Complexed With Gmp
          Length = 148

 Score = 35.0 bits (79), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 4/62 (6%)

Query: 160 GPVMKRH-GITNLSRVLIFFYDHQN--ELKRLKQALKVGFRHLVFEDNYDTGTGDHYSLR 216
           G ++ R  GI ++  V I  YDH N  ELK LK+A   G   +V +D  DTG G   ++R
Sbjct: 41  GALLARELGIRHVDTVAISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTG-GTAVAIR 99

Query: 217 QL 218
           ++
Sbjct: 100 EM 101


>pdb|1NUL|A Chain A, Xprtase From E. Coli
 pdb|1NUL|B Chain B, Xprtase From E. Coli
 pdb|1A95|A Chain A, Xprtase From E. Coli Complexed With Mg:cprpp And Guanine
 pdb|1A95|B Chain B, Xprtase From E. Coli Complexed With Mg:cprpp And Guanine
 pdb|1A95|C Chain C, Xprtase From E. Coli Complexed With Mg:cprpp And Guanine
 pdb|1A95|D Chain D, Xprtase From E. Coli Complexed With Mg:cprpp And Guanine
 pdb|1A96|A Chain A, Xprtase From E. Coli With Bound Cprpp And Xanthine
 pdb|1A96|B Chain B, Xprtase From E. Coli With Bound Cprpp And Xanthine
 pdb|1A96|C Chain C, Xprtase From E. Coli With Bound Cprpp And Xanthine
 pdb|1A96|D Chain D, Xprtase From E. Coli With Bound Cprpp And Xanthine
          Length = 152

 Score = 34.7 bits (78), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 4/62 (6%)

Query: 160 GPVMKRH-GITNLSRVLIFFYDHQN--ELKRLKQALKVGFRHLVFEDNYDTGTGDHYSLR 216
           G ++ R  GI ++  V I  YDH N  ELK LK+A   G   +V +D  DTG G   ++R
Sbjct: 43  GALLARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTG-GTAVAIR 101

Query: 217 QL 218
           ++
Sbjct: 102 EM 103


>pdb|3GZX|A Chain A, Crystal Structure Of The Biphenyl Dioxygenase In Complex
           With Biphenyl From Comamonas Testosteroni Sp. Strain
           B-356
 pdb|3GZY|A Chain A, Crystal Structure Of The Biphenyl Dioxygenase From
           Comamonas Testosteroni Sp. Strain B-356
          Length = 457

 Score = 32.0 bits (71), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 135 LDLMIESGAFKDIQPGFCGFGSIDWGPVMKR 165
           +++  E  AF D + G CGF   DWGP+  R
Sbjct: 134 VNVPFEKEAFCDKKEGDCGFDKADWGPLQAR 164


>pdb|1WQL|A Chain A, Cumene Dioxygenase (Cuma1a2) From Pseudomonas Fluorescens
           Ip01
          Length = 459

 Score = 32.0 bits (71), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 15/26 (57%)

Query: 140 ESGAFKDIQPGFCGFGSIDWGPVMKR 165
           E  AF D + G CGF   DWGP+  R
Sbjct: 140 EKEAFCDKKEGDCGFDKADWGPLQAR 165


>pdb|2XR8|A Chain A, Crystal Structure Of Biphenyl Dioxygenase From
           Burkholderia Xenovorans Lb400
 pdb|2XR8|C Chain C, Crystal Structure Of Biphenyl Dioxygenase From
           Burkholderia Xenovorans Lb400
 pdb|2XR8|E Chain E, Crystal Structure Of Biphenyl Dioxygenase From
           Burkholderia Xenovorans Lb400
 pdb|2XR8|G Chain G, Crystal Structure Of Biphenyl Dioxygenase From
           Burkholderia Xenovorans Lb400
 pdb|2XR8|I Chain I, Crystal Structure Of Biphenyl Dioxygenase From
           Burkholderia Xenovorans Lb400
 pdb|2XR8|K Chain K, Crystal Structure Of Biphenyl Dioxygenase From
           Burkholderia Xenovorans Lb400
 pdb|2XR8|M Chain M, Crystal Structure Of Biphenyl Dioxygenase From
           Burkholderia Xenovorans Lb400
 pdb|2XR8|O Chain O, Crystal Structure Of Biphenyl Dioxygenase From
           Burkholderia Xenovorans Lb400
 pdb|2XR8|Q Chain Q, Crystal Structure Of Biphenyl Dioxygenase From
           Burkholderia Xenovorans Lb400
 pdb|2XR8|S Chain S, Crystal Structure Of Biphenyl Dioxygenase From
           Burkholderia Xenovorans Lb400
 pdb|2XR8|U Chain U, Crystal Structure Of Biphenyl Dioxygenase From
           Burkholderia Xenovorans Lb400
 pdb|2XR8|W Chain W, Crystal Structure Of Biphenyl Dioxygenase From
           Burkholderia Xenovorans Lb400
 pdb|2XRX|A Chain A, Crystal Structure Of Biphenyl Dioxygenase In Complex With
           Biphenyl From Burkholderia Xenovorans Lb400
 pdb|2XRX|C Chain C, Crystal Structure Of Biphenyl Dioxygenase In Complex With
           Biphenyl From Burkholderia Xenovorans Lb400
 pdb|2XRX|E Chain E, Crystal Structure Of Biphenyl Dioxygenase In Complex With
           Biphenyl From Burkholderia Xenovorans Lb400
 pdb|2XRX|G Chain G, Crystal Structure Of Biphenyl Dioxygenase In Complex With
           Biphenyl From Burkholderia Xenovorans Lb400
 pdb|2XRX|I Chain I, Crystal Structure Of Biphenyl Dioxygenase In Complex With
           Biphenyl From Burkholderia Xenovorans Lb400
 pdb|2XRX|K Chain K, Crystal Structure Of Biphenyl Dioxygenase In Complex With
           Biphenyl From Burkholderia Xenovorans Lb400
 pdb|2XRX|M Chain M, Crystal Structure Of Biphenyl Dioxygenase In Complex With
           Biphenyl From Burkholderia Xenovorans Lb400
 pdb|2XRX|O Chain O, Crystal Structure Of Biphenyl Dioxygenase In Complex With
           Biphenyl From Burkholderia Xenovorans Lb400
 pdb|2XRX|Q Chain Q, Crystal Structure Of Biphenyl Dioxygenase In Complex With
           Biphenyl From Burkholderia Xenovorans Lb400
 pdb|2XRX|S Chain S, Crystal Structure Of Biphenyl Dioxygenase In Complex With
           Biphenyl From Burkholderia Xenovorans Lb400
 pdb|2XRX|U Chain U, Crystal Structure Of Biphenyl Dioxygenase In Complex With
           Biphenyl From Burkholderia Xenovorans Lb400
 pdb|2XRX|W Chain W, Crystal Structure Of Biphenyl Dioxygenase In Complex With
           Biphenyl From Burkholderia Xenovorans Lb400
          Length = 459

 Score = 30.0 bits (66), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 135 LDLMIESGAFKDIQPGFCGFGSIDWGPVMKR 165
           +++  E  AF D + G CGF   +WGP+  R
Sbjct: 134 VNVPFEKEAFCDKKEGDCGFDKAEWGPLQAR 164


>pdb|2XSH|A Chain A, Crystal Structure Of P4 Variant Of Biphenyl Dioxygenase
           From Burkholderia Xenovorans Lb400 In Complex With 2,6
           Di Chlorobiphenyl
 pdb|2XSH|C Chain C, Crystal Structure Of P4 Variant Of Biphenyl Dioxygenase
           From Burkholderia Xenovorans Lb400 In Complex With 2,6
           Di Chlorobiphenyl
 pdb|2XSH|E Chain E, Crystal Structure Of P4 Variant Of Biphenyl Dioxygenase
           From Burkholderia Xenovorans Lb400 In Complex With 2,6
           Di Chlorobiphenyl
 pdb|2XSH|G Chain G, Crystal Structure Of P4 Variant Of Biphenyl Dioxygenase
           From Burkholderia Xenovorans Lb400 In Complex With 2,6
           Di Chlorobiphenyl
 pdb|2XSH|I Chain I, Crystal Structure Of P4 Variant Of Biphenyl Dioxygenase
           From Burkholderia Xenovorans Lb400 In Complex With 2,6
           Di Chlorobiphenyl
 pdb|2XSH|K Chain K, Crystal Structure Of P4 Variant Of Biphenyl Dioxygenase
           From Burkholderia Xenovorans Lb400 In Complex With 2,6
           Di Chlorobiphenyl
 pdb|2XSO|A Chain A, Crystal Structure Of P4 Variant Of Biphenyl Dioxygenase
           From Burkholderia Xenovorans Lb400
 pdb|2XSO|C Chain C, Crystal Structure Of P4 Variant Of Biphenyl Dioxygenase
           From Burkholderia Xenovorans Lb400
 pdb|2XSO|E Chain E, Crystal Structure Of P4 Variant Of Biphenyl Dioxygenase
           From Burkholderia Xenovorans Lb400
 pdb|2XSO|G Chain G, Crystal Structure Of P4 Variant Of Biphenyl Dioxygenase
           From Burkholderia Xenovorans Lb400
 pdb|2XSO|I Chain I, Crystal Structure Of P4 Variant Of Biphenyl Dioxygenase
           From Burkholderia Xenovorans Lb400
 pdb|2XSO|K Chain K, Crystal Structure Of P4 Variant Of Biphenyl Dioxygenase
           From Burkholderia Xenovorans Lb400
 pdb|2XSO|M Chain M, Crystal Structure Of P4 Variant Of Biphenyl Dioxygenase
           From Burkholderia Xenovorans Lb400
 pdb|2XSO|O Chain O, Crystal Structure Of P4 Variant Of Biphenyl Dioxygenase
           From Burkholderia Xenovorans Lb400
 pdb|2XSO|Q Chain Q, Crystal Structure Of P4 Variant Of Biphenyl Dioxygenase
           From Burkholderia Xenovorans Lb400
 pdb|2XSO|S Chain S, Crystal Structure Of P4 Variant Of Biphenyl Dioxygenase
           From Burkholderia Xenovorans Lb400
 pdb|2XSO|U Chain U, Crystal Structure Of P4 Variant Of Biphenyl Dioxygenase
           From Burkholderia Xenovorans Lb400
 pdb|2XSO|W Chain W, Crystal Structure Of P4 Variant Of Biphenyl Dioxygenase
           From Burkholderia Xenovorans Lb400
          Length = 459

 Score = 30.0 bits (66), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 135 LDLMIESGAFKDIQPGFCGFGSIDWGPVMKR 165
           +++  E  AF D + G CGF   +WGP+  R
Sbjct: 134 VNVPFEKEAFCDKKEGDCGFDKAEWGPLQAR 164


>pdb|2YFI|A Chain A, Crystal Structure Of Biphenyl Dioxygenase Variant Rr41
           (Bpdo-Rr41)
 pdb|2YFI|C Chain C, Crystal Structure Of Biphenyl Dioxygenase Variant Rr41
           (Bpdo-Rr41)
 pdb|2YFI|E Chain E, Crystal Structure Of Biphenyl Dioxygenase Variant Rr41
           (Bpdo-Rr41)
 pdb|2YFI|G Chain G, Crystal Structure Of Biphenyl Dioxygenase Variant Rr41
           (Bpdo-Rr41)
 pdb|2YFI|I Chain I, Crystal Structure Of Biphenyl Dioxygenase Variant Rr41
           (Bpdo-Rr41)
 pdb|2YFI|K Chain K, Crystal Structure Of Biphenyl Dioxygenase Variant Rr41
           (Bpdo-Rr41)
 pdb|2YFJ|A Chain A, Crystal Structure Of Biphenyl Dioxygenase Variant Rr41
           With Dibenzofuran
 pdb|2YFJ|C Chain C, Crystal Structure Of Biphenyl Dioxygenase Variant Rr41
           With Dibenzofuran
 pdb|2YFJ|E Chain E, Crystal Structure Of Biphenyl Dioxygenase Variant Rr41
           With Dibenzofuran
 pdb|2YFJ|G Chain G, Crystal Structure Of Biphenyl Dioxygenase Variant Rr41
           With Dibenzofuran
 pdb|2YFJ|I Chain I, Crystal Structure Of Biphenyl Dioxygenase Variant Rr41
           With Dibenzofuran
 pdb|2YFJ|K Chain K, Crystal Structure Of Biphenyl Dioxygenase Variant Rr41
           With Dibenzofuran
 pdb|2YFL|A Chain A, Crystal Structure Of Biphenyl Dioxygenase Variant Rr41
           With 2-Chloro Dibenzofuran
 pdb|2YFL|C Chain C, Crystal Structure Of Biphenyl Dioxygenase Variant Rr41
           With 2-Chloro Dibenzofuran
 pdb|2YFL|E Chain E, Crystal Structure Of Biphenyl Dioxygenase Variant Rr41
           With 2-Chloro Dibenzofuran
 pdb|2YFL|G Chain G, Crystal Structure Of Biphenyl Dioxygenase Variant Rr41
           With 2-Chloro Dibenzofuran
 pdb|2YFL|I Chain I, Crystal Structure Of Biphenyl Dioxygenase Variant Rr41
           With 2-Chloro Dibenzofuran
 pdb|2YFL|K Chain K, Crystal Structure Of Biphenyl Dioxygenase Variant Rr41
           With 2-Chloro Dibenzofuran
          Length = 459

 Score = 30.0 bits (66), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 135 LDLMIESGAFKDIQPGFCGFGSIDWGPVMKR 165
           +++  E  AF D + G CGF   +WGP+  R
Sbjct: 134 VNVPFEKEAFCDKKEGDCGFDKAEWGPLQAR 164


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.144    0.471 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,471,112
Number of Sequences: 62578
Number of extensions: 320869
Number of successful extensions: 868
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 857
Number of HSP's gapped (non-prelim): 10
length of query: 225
length of database: 14,973,337
effective HSP length: 95
effective length of query: 130
effective length of database: 9,028,427
effective search space: 1173695510
effective search space used: 1173695510
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)