Citrus Sinensis ID: 047388

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350--
MIATLKAEEQSQLQLVEREDIDDEEDLFEAIDKLISQGINAGDVKKLQDAGIYTCNGLMMHTKKHLTGIKGLSEAKVEKICEAAEKIVNFGYITGSDALLRRKAVIKITTGSQALDELLGGGIETGAITEAFGEFRSGKTQLAHTLCVCTQLPTNMRGGNGKVAYIDTEGTFRPDRIVPIAERFGMDPGAVLDNIIYARAYTYEHQYNLLLGLAAKMSEEPFRLLIVDSVIALFRVDFTGRGELADRQQKLGQMLSRLTKISEEFNVAVYMTNQVIADPGGGVFISDPKKPAGGHVLAHAVTIRLMFRKGKGEQRVCKVFDAPNLPEAEAISFSYHIILIKITPGGIADAKD
cccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHcccHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHHHccccEEEcccHHHHHHHcccccccEEEEcccccccccccEEEEEHHcccccccccccccEEEEEEccccccHHHHHHHHHHHccccHHHcccEEEEEcccHHHHHHHHHHHHHHcccccEEEEEEEEEEEEEEECccccccHHHHHHHHHHHHHHHHHHHHHHccEEEEEccEEEcccccccccccccccccccccccccEEEEEECccccCEEEEEECcccccccccccEEEEEEEEEEcccccccccc
**************************LFEAIDKLISQGINAGDVKKLQDAGIYTCNGLMMHTKKHLTGIKGLSEAKVEKICEAAEKIVNFGYITGSDALLRRKAVIKITTGSQALDELLGGGIETGAITEAFGEFRSGKTQLAHTLCVCTQLPTNMRGGNGKVAYIDTEGTFRPDRIVPIAERFGMDPGAVLDNIIYARAYTYEHQYNLLLGLAAKMSEEPFRLLIVDSVIALFRVDFTGRGELADRQQKLGQMLSRLTKISEEFNVAVYMTNQVIADPGGGVFISDPKKPAGGHVLAHAVTIRLMFRKGKGEQRVCKVFDAPNLPEAEAISFSYHIILIKITPGGI*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIATLKAEEQSQLQLVEREDIDDEEDLFEAIDKLISQGINAGDVKKLQDAGIYTCNGLMMHTKKHLTGIKGLSEAKVEKICEAAEKIVNFGYITGSDALLRRKAVIKITTGSQALDELLGGGIETGAITEAFGEFRSGKTQLAHTLCVCTQLPTNMRGGNGKVAYIDTEGTFRPDRIVPIAERFGMDPGAVLDNIIYARAYTYEHQYNLLLGLAAKMSEEPFRLLIVDSVIALFRVDFTGRGELADRQQKLGQMLSRLTKISEEFNVAVYMTNQVIADPGGGVFISDPKKPAGGHVLAHAVTIRLMFRKGKGEQRVCKVFDAPNLPEAEAISFSYHIILIKITPGGIADAKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Meiotic recombination protein DMC1 homolog May participate in meiotic recombination.confidentQ96449
Meiotic recombination protein DMC1 homolog May participate in meiotic recombination.confidentQ39009
Meiotic recombination protein dmc1 Required for meiotic recombination and cell cycle progression. Binds to single and double stranded DNA, in the presence of magnesium, and exhibits DNA-dependent ATPase activity. Promotes DNA strand annealing and strand exchange via DNA recombinase activity and forms helical and stacked ring nucleoprotein filaments.probableO42634

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CMU, chain A
Confidence level:very confident
Coverage over the Query: 39-348
View the alignment between query and template
View the model in PyMOL
Template: 1V5W, chain A
Confidence level:very confident
Coverage over the Query: 90-275,294-352
View the alignment between query and template
View the model in PyMOL