BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 047435
         (724 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution
          Length = 218

 Score = 30.8 bits (68), Expect = 3.0,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 9/72 (12%)

Query: 308 FSFILNVKGINEFMLLNRLRVNFKTI---DEASYA------TMVLSHLAVNAIVTPIICI 358
           FS I  V+GIN+ +  N L ++ + +   D+ SY       T  L ++A N + T  +  
Sbjct: 28  FSTIATVEGINKIVTGNLLELSEQELVDCDKHSYGCKGGYQTTSLQYVANNGVHTSKVYP 87

Query: 359 YHKPQTRCKVTE 370
           Y   Q +C+ T+
Sbjct: 88  YQAKQYKCRATD 99


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.140    0.411 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 18,736,555
Number of Sequences: 62578
Number of extensions: 718634
Number of successful extensions: 1804
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 1804
Number of HSP's gapped (non-prelim): 5
length of query: 724
length of database: 14,973,337
effective HSP length: 106
effective length of query: 618
effective length of database: 8,340,069
effective search space: 5154162642
effective search space used: 5154162642
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 55 (25.8 bits)