Citrus Sinensis ID: 047445

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430------

MVETAAKSSRPHVAVLASPGLGHVVPLLEFAKRLVINHGVHVRFLVITTNEASAAQEKLLRSLPDGLDVVDLPPVDVSAVTRDDMPVITRLHAIVDESLKSSLKAVLIELCNPRALVIDLFCTQAFEICSQLSIPTYSFVTTSIHFFAFALYLPTLDREVQGEFFDLPEPIEIPGCPPVRPEDLLDQVRNRKIDEYNLFLLHISRLPLAAGIFLNPWENLELVPLRAIREHSFYLQIPTPPIYPIGPLIKQDETLSASDEECLAWLGKQPSDSVIFVAPGSGGTLTAEQVIEMAWGLEQSKQRFIWVVRMPSDASASATFFNVGSDVNDPQAYLPEGFLQRTHGMGMVVPSWAPQVEILRHSSTGGFLSHCGWNSSLESICHGVPMIAWPLYAEQKMNAAMLTEETRGGRKASNRIGKESDRTGRDREGSEVGDGE

cccccccccccEEEEEcccccccHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHcccccccEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHccccCEEEEcHHHHHHHHHHHHHHHHHccccccccccccCCcccccccccccccccccccccHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHcccccccccccccEEcccccccccccccccccHHHHHcccccccEEEEcccccccccHHHHHHHHHHHHHccccEEEEEccccccccccccccccccccccccccccHHHHHHcccccEEcccccHHHHccccccccccccccccHHHHHHHcccccccccccccccHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHcccc

************VAVLASPGLGHVVPLLEFAKRLVINHGVHVRFLVITTNEASAAQEKLLRSLPDGLDVVDLPPVDVSAVTRDDMPVITRLHAIVDESLKSSLKAVLIELCNPRALVIDLFCTQAFEICSQLSIPTYSFVTTSIHFFAFALYLPTLDREVQGEFFDLPEPIEIPGCPPVRPEDLLDQVRNRKIDEYNLFLLHISRLPLAAGIFLNPWENLELVPLRAIREHSFYLQIPTPPIYPIGPLIKQDETLSASDEECLAWLGKQPSDSVIFVAPGSGGTLTAEQVIEMAWGLEQSKQRFIWVVRMPSDASASAT*FNVGSDVNDPQAYLPEGFLQRTHGMGMVVPSWAPQVEILRHSSTGGFLSHCGWNSSLESICHGVPMIAWPLYAEQKMNAAMLTEETRGGRKASNRIGKESDRTGRDREGSEVGD**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
UDP-glycosyltransferase 72E3	Involved in the O-glucosylation of monolignols (alcohol monomers of lignin). Acts with low specific activity on conyferyl and sinapyl alcohols to form coniferyl alcohol 4-O-glucoside and sinapyl alcohol 4-O-glucoside, respectively. Possesses low activity with sinapate as substrate.	probable	O81498

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.4.-.-	Glycosyltransferases.	probable
2.4.1.-	Hexosyltransferases.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VCH, chain A
Confidence level:very confident
Coverage over the Query: 10-431
View the alignment between query and template
View the model in PyMOL