BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 047456
         (71 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q9LV66|Y5848_ARATH Uncharacterized protein At5g48480 OS=Arabidopsis thaliana
          GN=At5g48480 PE=1 SV=1
          Length = 166

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%)

Query: 10 FMGMKPQLLVEASKATGSVQFYEIAFGAVEISRNMETKRKAEQELNSRLPKDCN 63
          F   K  LLVEA K   +V FY+ AFGA+E   ++  KRK +QEL   L  + N
Sbjct: 23 FTEFKQMLLVEAQKVGDAVTFYKSAFGAIESGHSLYPKRKLDQELPHVLSSELN 76


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.314    0.125    0.334 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 20,227,805
Number of Sequences: 539616
Number of extensions: 501880
Number of successful extensions: 1249
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1248
Number of HSP's gapped (non-prelim): 3
length of query: 71
length of database: 191,569,459
effective HSP length: 43
effective length of query: 28
effective length of database: 168,365,971
effective search space: 4714247188
effective search space used: 4714247188
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 55 (25.8 bits)