Citrus Sinensis ID: 047502

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MEVSSQFRQIFKVMDSNGDGKLSSSELGEVLICLGCDKSNATKEAEGMLKQMDYNGDGFIDVDEFMDAVHDDSGGKPKEDYLMDAFLIFDINKNGLISAMELRRVLINLGCDKCTLEDCRRMIKGVDKDGDGFVDFEEFRSMLSH
ccHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccHHHHHHHHHcccccccccccHHHHHHHHcc
MEVSSQFRQIFKVMDSNGDGKLSSSELGEVLICLGCDKSNATKEAEGMLKQMDYNGDGFIDVDEFMDAVH********EDYLMDAFLIFDINKNGLISAMELRRVLINLGCDKCTLEDCRRMIKGVDKDGDGFVDFEEFRSMLSH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVSSQFRQIFKVMDSNGDGKLSSSELGEVLICLGCDKSNATKEAEGMLKQMDYNGDGFIDVDEFMDAVHDDSGGKPKEDYLMDAFLIFDINKNGLISAMELRRVLINLGCDKCTLEDCRRMIKGVDKDGDGFVDFEEFRSMLSH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calmodulin Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases (By similarity). Together with CEP110 and centrin, is involved in a genetic pathway that regulates the centrosome cycle and progression through cytokinesis.probableQ5RAD2
Calmodulin Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases.probableP62152
Calmodulin Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases. Together with CEP110 and centrin, is involved in a genetic pathway that regulates the centrosome cycle and progression through cytokinesis.probableP62158

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F2O, chain A
Confidence level:very confident
Coverage over the Query: 1-144
View the alignment between query and template
View the model in PyMOL