Citrus Sinensis ID: 047503


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920
MAEAAVNLVIETLGSLLVQEINLLGSTKQEVQSIKNELESIRSFLKDADAREAAEEEEGESNEGVKTWVKQVREEAFRIEDVIDEYILKEAKLARGSGLTYHLRKFFCFINVLKLHHGIASKIEVIKSSLADIQRRERHYSFRSIEQGSVSRTRNVISHDPRVGSLFIEDDEVVGIESARDILIGWLVNGRKQRSVVALVGQGGIGKTTLAGKLFNNQYVMNHFDCRAWITVGRECMKKDLLIKMIKEFHQLTGQSALGEMNNMEEKDLIIAVRQYLHDKNYMIVLDDVWKIELWGDVEHALLDNKKGSRIMLTTRHKAVADFCKQSSFVQVHELEALPAVEAWRLFCRKAFASVSDGGCPPELEKLSHEIVAKCGGLPLAIVAVGGLLSTKHGSVSEWRRSLEGLGSKLGSDPHLKICSRVLSEGYHDLPHHLKSCLLYFGLFPQGYSISCARLIRLWIAEGFVPYSTRPPSEQLGEEYLSELIDRSLVHVSRRARSCRVHDLMHEIILEKTKDLGFCLDLSREDLSCCTKTRRISINQSLNNVLEWTEDSKIRSVFFLNVDKLPGSFMTKLVAEFKLMKVLDFEDAPIEFLPEEVGNLFHLHYLSVRNTKVKVLPKSIGRLLNLQTLDLKHSLVTQLPVEIKNLKKLRYLLVYHSDNGTHERGVKIQEGFGSLTDLQKLYIVQANSTILKELRKLRQLRKLGIQLTNDDGKNLCASIADMENLESLTVESTSREETFDIQSLGSPPQYLEHLYLVGSMKNLPDWIFKLKNLVRIGLYWSELTNDPMNVLQALPNLLELRLRDAYDYEKLHFKDGWFPRLQRLVLLDLKGVTLMMIDKGAMPCLRELKIGPCPLLKEIPAGIEHLRNLEILKFCGMLTVIASMIDDANWQKIIELVPCVFVSFKRAGKNVYKPVQLARN
cHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEECccccHHHHHHHHHccccccEEEEEEcccccccHHHHHHHcccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHccccccccEEEEEcccHHHHHHccccccccEEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccHHHHHHHHHcccccccccHHHHHHccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccEEcccccEEEEcHHHHHHHHHHHcccccEEEcccccccccccEEEEEEEccccccccccccccEEEEEEEccccccccccccccccccEEEEEECccccccccccccccccccccccccccccccccccccccccccEEEccccccccccHHHHcccccccEEEccccccccccccccccccccccccccccEEEcccHHHHHHHccccccEEEEEEEccccHHHHHHccccccccEEEEEEcccccccccccccccccccEEEEEEEEccccccccccccccEEEEEEECcccccccHHccccccccEEEEEEcccccEEEECcccccccccEEcccccccEEEECcccccccccEEEECcccccccccccccccccccEEEEEccHHHHHHHcccccHHHHHccccEEEEEEECcccccccccccccc
MAEAAVNLVIETLGSLLVQEINLLGSTKQEVQSIKNELESIRSFLKDADAREA******ESNEGVKTWVKQVREEAFRIEDVIDEYILKEAKLARGSGLTYHLRKFFCFINVLKLHHGIASKIEVIKSSLADIQRRERHYSFR*****************PRVGSLFIEDDEVVGIESARDILIGWLVNGRKQRSVVALVGQGGIGKTTLAGKLFNNQYVMNHFDCRAWITVGRECMKKDLLIKMIKEFHQLTGQSALGEMNNMEEKDLIIAVRQYLHDKNYMIVLDDVWKIELWGDVEHALLDNKKGSRIMLTTRHKAVADFCKQSSFVQVHELEALPAVEAWRLFCRKAFASVSDGGCPPELEKLSHEIVAKCGGLPLAIVAVGGLLSTKHGSVSEWRRSLEGLGSKLGSDPHLKICSRVLSEGYHDLPHHLKSCLLYFGLFPQGYSISCARLIRLWIAEGFVPYSTRPPSEQLGEEYLSELIDRSLVHVSRRARSCRVHDLMHEIILEKTKDLGFCLDLSREDLSCCTKTRRISINQSLNNVLEWTEDSKIRSVFFLNVDKLPGSFMTKLVAEFKLMKVLDFEDAPIEFLPEEVGNLFHLHYLSVRNTKVKVLPKSIGRLLNLQTLDLKHSLVTQLPVEIKNLKKLRYLLVYHSDNGTHERGVKIQEGFGSLTDLQKLYIVQANSTILKELRKLRQLRKLGIQLTNDDGKNLCASIADMENLESLTVESTSREETFDIQSLGSPPQYLEHLYLVGSMKNLPDWIFKLKNLVRIGLYWSELTNDPMNVLQALPNLLELRLRDAYDYEKLHFKDGWFPRLQRLVLLDLKGVTLMMIDKGAMPCLRELKIGPCPLLKEIPAGIEHLRNLEILKFCGMLTVIASMIDDANWQKIIELVPCVFVSFKRAGKNVYK*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEAAVNLVIETLGSLLVQEINLLGSTKQEVQSIKNELESIRSFLKDADAREAAEEEEGESNEGVKTWVKQVREEAFRIEDVIDEYILKEAKLARGSGLTYHLRKFFCFINVLKLHHGIASKIEVIKSSLADIQRRERHYSFRSIEQGSVSRTRNVISHDPRVGSLFIEDDEVVGIESARDILIGWLVNGRKQRSVVALVGQGGIGKTTLAGKLFNNQYVMNHFDCRAWITVGRECMKKDLLIKMIKEFHQLTGQSALGEMNNMEEKDLIIAVRQYLHDKNYMIVLDDVWKIELWGDVEHALLDNKKGSRIMLTTRHKAVADFCKQSSFVQVHELEALPAVEAWRLFCRKAFASVSDGGCPPELEKLSHEIVAKCGGLPLAIVAVGGLLSTKHGSVSEWRRSLEGLGSKLGSDPHLKICSRVLSEGYHDLPHHLKSCLLYFGLFPQGYSISCARLIRLWIAEGFVPYSTRPPSEQLGEEYLSELIDRSLVHVSRRARSCRVHDLMHEIILEKTKDLGFCLDLSREDLSCCTKTRRISINQSLNNVLEWTEDSKIRSVFFLNVDKLPGSFMTKLVAEFKLMKVLDFEDAPIEFLPEEVGNLFHLHYLSVRNTKVKVLPKSIGRLLNLQTLDLKHSLVTQLPVEIKNLKKLRYLLVYHSDNGTHERGVKIQEGFGSLTDLQKLYIVQANSTILKELRKLRQLRKLGIQLTNDDGKNLCASIADMENLESLTVESTSREETFDIQSLGSPPQYLEHLYLVGSMKNLPDWIFKLKNLVRIGLYWSELTNDPMNVLQALPNLLELRLRDAYDYEKLHFKDGWFPRLQRLVLLDLKGVTLMMIDKGAMPCLRELKIGPCPLLKEIPAGIEHLRNLEILKFCGMLTVIASMIDDANWQKIIELVPCVFVSFKRAGKNVYKPVQLARN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Disease resistance protein RPM1 Disease resistance (R) protein that specifically recognizes the AvrRpm1 type III effector avirulence protein from Pseudomonas syringae. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. Acts via its interaction with RIN4, and probably triggers the plant resistance when RIN4 is phosphorylated by AvrRpm1. It is then degraded at the onset of the hypersensitive response.probableQ39214

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z63, chain A
Confidence level:very confident
Coverage over the Query: 551-687
View the alignment between query and template
View the model in PyMOL
Template: 2Z63, chain A
Confidence level:very confident
Coverage over the Query: 530-878
View the alignment between query and template
View the model in PyMOL
Template: 3SFZ, chain A
Confidence level:very confident
Coverage over the Query: 169-462,474-516
View the alignment between query and template
View the model in PyMOL
Template: 2A5Y, chain B
Confidence level:very confident
Coverage over the Query: 174-518
View the alignment between query and template
View the model in PyMOL
Template: 3QFL, chain A
Confidence level:very confident
Coverage over the Query: 4-119
View the alignment between query and template
View the model in PyMOL
Template: 3SHF, chain A
Confidence level:probable
Coverage over the Query: 145-462,473-514
View the alignment between query and template
View the model in PyMOL