BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 047567
         (121 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3BE8|A Chain A, Crystal Structure Of The Synaptic Protein Neuroligin 4
 pdb|3BE8|B Chain B, Crystal Structure Of The Synaptic Protein Neuroligin 4
 pdb|2WQZ|A Chain A, Crystal Structure Of Synaptic Protein Neuroligin-4 In
           Complex With Neurexin-beta 1: Alternative Refinement
 pdb|2WQZ|B Chain B, Crystal Structure Of Synaptic Protein Neuroligin-4 In
           Complex With Neurexin-beta 1: Alternative Refinement
 pdb|2XB6|A Chain A, Revisited Crystal Structure Of Neurexin1beta-neuroligin4
           Complex
 pdb|2XB6|B Chain B, Revisited Crystal Structure Of Neurexin1beta-neuroligin4
           Complex
          Length = 588

 Score = 26.2 bits (56), Expect = 4.4,   Method: Composition-based stats.
 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 10/63 (15%)

Query: 22  VNSIKSLKWVLVKTGEISPLMPR----------SCRYVPTCSEYSMQAYKKYGVVKGTVL 71
           ++ I++L+W+    G       R          SC  + T S YS   ++K  +  GT L
Sbjct: 194 LDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTAL 253

Query: 72  TAW 74
           ++W
Sbjct: 254 SSW 256


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.139    0.456 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,932,618
Number of Sequences: 62578
Number of extensions: 93050
Number of successful extensions: 228
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 228
Number of HSP's gapped (non-prelim): 1
length of query: 121
length of database: 14,973,337
effective HSP length: 83
effective length of query: 38
effective length of database: 9,779,363
effective search space: 371615794
effective search space used: 371615794
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)