BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 047567
(121 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3BE8|A Chain A, Crystal Structure Of The Synaptic Protein Neuroligin 4
pdb|3BE8|B Chain B, Crystal Structure Of The Synaptic Protein Neuroligin 4
pdb|2WQZ|A Chain A, Crystal Structure Of Synaptic Protein Neuroligin-4 In
Complex With Neurexin-beta 1: Alternative Refinement
pdb|2WQZ|B Chain B, Crystal Structure Of Synaptic Protein Neuroligin-4 In
Complex With Neurexin-beta 1: Alternative Refinement
pdb|2XB6|A Chain A, Revisited Crystal Structure Of Neurexin1beta-neuroligin4
Complex
pdb|2XB6|B Chain B, Revisited Crystal Structure Of Neurexin1beta-neuroligin4
Complex
Length = 588
Score = 26.2 bits (56), Expect = 4.4, Method: Composition-based stats.
Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 10/63 (15%)
Query: 22 VNSIKSLKWVLVKTGEISPLMPR----------SCRYVPTCSEYSMQAYKKYGVVKGTVL 71
++ I++L+W+ G R SC + T S YS ++K + GT L
Sbjct: 194 LDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTAL 253
Query: 72 TAW 74
++W
Sbjct: 254 SSW 256
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.327 0.139 0.456
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,932,618
Number of Sequences: 62578
Number of extensions: 93050
Number of successful extensions: 228
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 228
Number of HSP's gapped (non-prelim): 1
length of query: 121
length of database: 14,973,337
effective HSP length: 83
effective length of query: 38
effective length of database: 9,779,363
effective search space: 371615794
effective search space used: 371615794
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)