BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 047579
         (359 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1ULI|B Chain B, Biphenyl Dioxygenase (bpha1a2) Derived From Rhodococcus
           Sp. Strain Rha1
 pdb|1ULI|D Chain D, Biphenyl Dioxygenase (bpha1a2) Derived From Rhodococcus
           Sp. Strain Rha1
 pdb|1ULI|F Chain F, Biphenyl Dioxygenase (bpha1a2) Derived From Rhodococcus
           Sp. Strain Rha1
 pdb|1ULJ|B Chain B, Biphenyl Dioxygenase (Bpha1a2) In Complex With The
           Substrate
 pdb|1ULJ|D Chain D, Biphenyl Dioxygenase (Bpha1a2) In Complex With The
           Substrate
 pdb|1ULJ|F Chain F, Biphenyl Dioxygenase (Bpha1a2) In Complex With The
           Substrate
          Length = 187

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 1/68 (1%)

Query: 90  PTTRGNSILQGVNYASGGG-GILNQTGKIFGGRINMDAQLDNFANTRQDIISTIGEPATL 148
           P +R   ++  V    G   G  + +      R  ++ QLD FA  R+DI+   G  A  
Sbjct: 105 PASRTRHVISNVMIVDGEKPGEYHVSSVFIVYRNRLERQLDIFAGERKDILRRTGSEAGF 164

Query: 149 QLLRRSLF 156
           +L +R++ 
Sbjct: 165 ELAKRTIL 172


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.138    0.407 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,505,456
Number of Sequences: 62578
Number of extensions: 448701
Number of successful extensions: 975
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 974
Number of HSP's gapped (non-prelim): 1
length of query: 359
length of database: 14,973,337
effective HSP length: 100
effective length of query: 259
effective length of database: 8,715,537
effective search space: 2257324083
effective search space used: 2257324083
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)