Citrus Sinensis ID: 047593

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510------
MASLDTVLLREITVAALLIFLITRYFIRFPIRKSSRPLPPGPKGFPIIGALPLLLLGAMPHVTLAKMAKKYGPVMYLKMGTCDMVVASTPDAARAFLKTLDLNFSNRPPNAGATHLAYDAQDMVFADYGPRWKLLRKISNLHMLGGKALYDWSNVRNIELGHMLRAICESSQRNEPVVVPEMLTYAMANMIGQVILSRRVFVTKGTESNEFKDMVVELMTSAGFFNIGDFIPSIAWLDLQGIERGMKKLHNRFDVLLTKMIEEHMASTYERKRKPDFLDIVMANRENSDGERLTITNIKALLLNLFTAGTDTSSSIIEWALAEMLKNPSIMKGAQQEMDQVIGRNRRLEESDIEKLPYLKAICKETFRKHPSTPLNLPRVSTEACVINGYYIPRGTRLSVNIWAVGRDPDVWKDPLNFDPERFLSDEKYAKMDPRGNDFELIPFGAGRRICAGARMGIVLVEYILGTLVHSFEWKLPDGDDQDQLNMDETFGLALQKAVPLSALLRPRLAPSAYAS
ccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHccccEEEEcccccEEEEccHHHHHHHHHHcccccccccccHHHHHHHcccccEEEccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccECHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccccccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHcccccccccccccccccccEEccEEcccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEECcccccccccc
**SLDTVLLREITVAALLIFLITRYFIRFPIRK*********KGFPIIGALPLLLLGAMPHVTLAKMAKKYGPVMYLKMGTCDMVVASTPDAARAFLKTLDLNFSNRPPNAGATHLAYDAQDMVFADYGPRWKLLRKISNLHMLGGKALYDWSNVRNIELGHMLRAICESSQRNEPVVVPEMLTYAMANMIGQVILSRRVFVTKGTESNEFKDMVVELMTSAGFFNIGDFIPSIAWLDLQGIERGMKKLHNRFDVLLTKMIEEHMASTY**KRKPDFLDIVMANRENSDGERLTITNIKALLLNLFTAGTDTSSSIIEWALAEMLKNPSIMKGAQQEMDQVIGRNRRLEESDIEKLPYLKAICKETFRKHPSTPLNLPRVSTEACVINGYYIPRGTRLSVNIWAVGRDPDVWKDPLNFDPERFLSDEKYAKMDPRGNDFELIPFGAGRRICAGARMGIVLVEYILGTLVHSFEWKLPDGDDQDQLNMDETFGLALQKAVPLSALLRPRLAPSAY**
xxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASLDTVLLREITVAALLIFLITRYFIRFPIRKSSRPLPPGPKGFPIIGALPLLLLGAMPHVTLAKMAKKYGPVMYLKMGTCDMVVASTPDAARAFLKTLDLNFSNRPPNAGATHLAYDAQDMVFADYGPRWKLLRKISNLHMLGGKALYDWSNVRNIELGHMLRAICESSQRNEPVVVPEMLTYAMANMIGQVILSRRVFVTKGTESNEFKDMVVELMTSAGFFNIGDFIPSIAWLDLQGIERGMKKLHNRFDVLLTKMIEEHMASTYERKRKPDFLDIVMANRENSDGERLTITNIKALLLNLFTAGTDTSSSIIEWALAEMLKNPSIxxxxxxxxxxxxxxxxxxxxxDIEKLPYLKAICKETFRKHPSTPLNLPRVSTEACVINGYYIPRGTRLSVNIWAVGRDPDVWKDPLNFDPERFLSDEKYAKMDPRGNDFELIPFGAGRRICAGARMGIVLVEYILGTLVHSFEWKLPDGDDQDQLNMDETFGLALQKAVPLSALLRPRLAPSAYAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Flavonoid 3',5'-hydroxylase 2 Catalyzes the 3'5'-hydroxylation of naringenin and eriodictyol to form 5,7,3,'4',5'-pentahydroxyflavanone and 3',5'-hydroxylation of dihydrokaempferol and dihydroquercetin to form dihydromyricetin.probableP48419
Flavonoid 3',5'-hydroxylase Catalyzes the 3'5'-hydroxylation of naringenin and eriodictyol to form 5,7,3,'4',5'-pentahydroxyflavanone and 3',5'-hydroxylation of dihydrokaempferol and dihydroquercetin to form dihydromyricetin.probableQ96581
Flavonoid 3',5'-hydroxylase Catalyzes the 3'5'-hydroxylation of naringenin and eriodictyol to form 5,7,3,'4',5'-pentahydroxyflavanone and 3',5'-hydroxylation of dihydrokaempferol and dihydroquercetin to form dihydromyricetin.probableP37120

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.14.-.-Acting on paired donors, with incorporation or reduction of molecular oxygen.probable
1.14.13.-With NADH or NADPH as one donor, and incorporation of one atom of oxygen.probable
1.14.13.88Flavonoid 3',5'-hydroxylase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PM0, chain A
Confidence level:very confident
Coverage over the Query: 58-513
View the alignment between query and template
View the model in PyMOL