BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 047603
         (259 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3KH8|A Chain A, Crystal Structure Of Maoc-Like Dehydratase From
           Phytophthora Capsici
 pdb|3KH8|B Chain B, Crystal Structure Of Maoc-Like Dehydratase From
           Phytophthora Capsici
          Length = 332

 Score = 30.4 bits (67), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 134 NYNQHLKGRKHKAKLQELKLDGNSL-VKMSLVK-VGEKQTWCR-LCNIGFSSEELFR 187
           ++N   K   H+A++  L  D NSL +   + K VG KQ     LC++G +S  LF+
Sbjct: 208 DFNDEFKTSPHQAQVYRLSGDYNSLHIDPEIAKSVGFKQPILHGLCSMGVASRALFK 264


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.132    0.405 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,256,818
Number of Sequences: 62578
Number of extensions: 273256
Number of successful extensions: 511
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 506
Number of HSP's gapped (non-prelim): 8
length of query: 259
length of database: 14,973,337
effective HSP length: 97
effective length of query: 162
effective length of database: 8,903,271
effective search space: 1442329902
effective search space used: 1442329902
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)