BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 047607
         (352 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1JTH|A Chain A, Crystal Structure And Biophysical Properties Of A
          Complex Between The N-Terminal Region Of Snap25 And The
          Snare Region Of Syntaxin 1a
 pdb|1JTH|C Chain C, Crystal Structure And Biophysical Properties Of A
          Complex Between The N-Terminal Region Of Snap25 And The
          Snare Region Of Syntaxin 1a
          Length = 82

 Score = 27.7 bits (60), Expect = 9.5,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 34 DNLKDLRRESQKLIEERNDVRIRVIVAEQQQMKRLERVQGWFSRVQDVLYEVDR 87
          ++L+  RR  Q L+EE  D  IR +V   +Q ++LER++    ++   + E ++
Sbjct: 24 ESLESTRRMLQ-LVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEK 76


>pdb|3RK2|C Chain C, Truncated Snare Complex
 pdb|3RK2|G Chain G, Truncated Snare Complex
 pdb|3RK3|C Chain C, Truncated Snare Complex With Complexin
 pdb|3RL0|C Chain C, Truncated Snare Complex With Complexin (P1)
 pdb|3RL0|G Chain G, Truncated Snare Complex With Complexin (P1)
 pdb|3RL0|K Chain K, Truncated Snare Complex With Complexin (P1)
 pdb|3RL0|O Chain O, Truncated Snare Complex With Complexin (P1)
 pdb|3RL0|S Chain S, Truncated Snare Complex With Complexin (P1)
 pdb|3RL0|W Chain W, Truncated Snare Complex With Complexin (P1)
 pdb|3RL0|AA Chain a, Truncated Snare Complex With Complexin (P1)
 pdb|3RL0|EE Chain e, Truncated Snare Complex With Complexin (P1)
          Length = 81

 Score = 27.7 bits (60), Expect = 9.7,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 34 DNLKDLRRESQKLIEERNDVRIRVIVAEQQQMKRLERVQGWFSRVQDVLYEVDR 87
          ++L+  RR  Q L+EE  D  IR +V   +Q ++L+RV+   + +   + E ++
Sbjct: 22 ESLESTRRMLQ-LVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEK 74


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.135    0.405 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,641,464
Number of Sequences: 62578
Number of extensions: 356726
Number of successful extensions: 915
Number of sequences better than 100.0: 13
Number of HSP's better than 100.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 907
Number of HSP's gapped (non-prelim): 13
length of query: 352
length of database: 14,973,337
effective HSP length: 100
effective length of query: 252
effective length of database: 8,715,537
effective search space: 2196315324
effective search space used: 2196315324
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)