Query         047622
Match_columns 300
No_of_seqs    170 out of 988
Neff          6.0 
Searched_HMMs 46136
Date          Fri Mar 29 13:01:08 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/047622.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/047622hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0 8.4E-42 1.8E-46  284.9   7.1  127    8-141     1-129 (129)
  2 PHA00692 hypothetical protein   24.6      31 0.00068   25.3   0.5   10    6-15     35-44  (74)
  3 PRK14129 heat shock protein Hs  18.7 1.1E+02  0.0025   24.9   2.7   21   36-56     18-38  (105)
  4 PF07960 CBP4:  CBP4;  InterPro  17.9      65  0.0014   27.3   1.1   11   15-25     30-40  (128)
  5 smart00265 BH4 BH4 Bcl-2 homol  16.8 1.5E+02  0.0033   18.4   2.3   19   17-35      4-22  (27)
  6 PRK02079 pyrroloquinoline quin  16.7      79  0.0017   24.8   1.3   15    1-15      1-15  (88)
  7 PF11285 DUF3086:  Protein of u  14.1      21 0.00046   33.7  -2.9   25   47-73    129-153 (283)
  8 COG3100 Uncharacterized protei  13.7 1.2E+02  0.0027   24.4   1.7   14  154-167    10-23  (103)
  9 smart00707 RPEL Repeat in Dros  13.7 1.2E+02  0.0027   18.6   1.3   13   11-23      6-18  (26)
 10 PRK14390 hypothetical protein;  13.3 1.1E+02  0.0023   22.8   1.2   20    4-23      9-28  (63)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=8.4e-42  Score=284.86  Aligned_cols=127  Identities=40%  Similarity=0.748  Sum_probs=92.3

Q ss_pred             CCCCCeeCCChHHHHHHHHhhhhcCCCCCCccceeecccccCCCCccchhhhcCCCCCCCCCceEEEecCcccCCCCCcc
Q 047622            8 LPLGCKFQPSDELLVQFYLFNKISGTPAPFVDDLVRTENLYGFKEPWQIWRQFGGPDLEDGEDLYFFTPLKKKSVNGSRI   87 (300)
Q Consensus         8 LPpGfRF~PTDeELV~~YL~~Ki~g~~lp~~~~I~d~DdvY~~~~PwdLp~~~~~~~~~~~~ewYFFs~r~~k~~~G~R~   87 (300)
                      |||||||+|||+|||.+||++|+.|.+++....|.++| ||+ +|||+|+..+.    .++++||||+++.+++.+|.|.
T Consensus         1 LP~G~rF~PtD~ELi~~yL~~k~~g~~~~~~~~i~~~D-iy~-~~P~~L~~~~~----~~~~~~yFF~~~~~~~~~~~r~   74 (129)
T PF02365_consen    1 LPPGFRFRPTDEELINHYLRPKILGEPLPCEDVIHDVD-IYS-AHPWELPAKFK----GGDEEWYFFSPRKKKYPNGGRP   74 (129)
T ss_dssp             --TTEEE---HHHHHHCTHHHHHTT-HHCS-CHSEE---GGG-S-GGGCHHHSS----S-SSEEEEEEE----------S
T ss_pred             CCCceEecCChHHHHHHHHHHHhcCCCCCcccceeecc-cCc-cChHHhhhhcc----CCCceEEEEEecccccCCcccc
Confidence            89999999999999999999999999988755688887 995 89999995432    3567999999999999999999


Q ss_pred             ccccccceeeecCCCceEEeCCCCceeeeEEEEEeecCCCC--CCcCeEEEEEEeC
Q 047622           88 DRRVGTGTWQGEDAGKAVVSRKSKKKIGSKKRFRYEKDKSP--HNGCWIMHEYSLN  141 (300)
Q Consensus        88 ~R~~g~G~Wk~tG~~k~I~~~~~g~viG~KktL~Fy~g~~~--~kT~WvMhEY~l~  141 (300)
                      +|++++|+||++|+.++|.+. ++.+||+|++|+||.++.+  .+|+|+||||+|.
T Consensus        75 ~R~~~~G~Wk~~g~~~~i~~~-~g~~iG~k~~l~f~~~~~~~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen   75 NRVTGGGYWKSTGKEKPIKDP-GGKVIGFKKTLVFYSGKSPNGKKTGWVMHEYSLE  129 (129)
T ss_dssp             -EEETTEEEEEECEEEEEEE--TTCEEEEEEEEEEEESSTTS-EEEEEEEEEEEE-
T ss_pred             cccccceEEeecccccccccc-cceeeeeEEEEEEEeccCCCCCcCCeEEEEEEeC
Confidence            999999999999999999975 7899999999999976443  4899999999984


No 2  
>PHA00692 hypothetical protein
Probab=24.64  E-value=31  Score=25.35  Aligned_cols=10  Identities=30%  Similarity=0.584  Sum_probs=7.9

Q ss_pred             CCCCCCCeeC
Q 047622            6 PPLPLGCKFQ   15 (300)
Q Consensus         6 ~~LPpGfRF~   15 (300)
                      ...||||||-
T Consensus        35 veyppgfrfg   44 (74)
T PHA00692         35 VEYPPGFRFG   44 (74)
T ss_pred             EecCCCcccc
Confidence            3579999994


No 3  
>PRK14129 heat shock protein HspQ; Provisional
Probab=18.72  E-value=1.1e+02  Score=24.95  Aligned_cols=21  Identities=19%  Similarity=0.336  Sum_probs=15.7

Q ss_pred             CCccceeecccccCCCCccch
Q 047622           36 PFVDDLVRTENLYGFKEPWQI   56 (300)
Q Consensus        36 p~~~~I~d~DdvY~~~~PwdL   56 (300)
                      +-...|+|+|.+|+..+||-.
T Consensus        18 ~yrGVV~DVDP~fs~~e~w~~   38 (105)
T PRK14129         18 GYLGVVVDIDPEYSLEEPSPD   38 (105)
T ss_pred             CCCeEEEeeCCCcCCCchhHH
Confidence            344679999999976788843


No 4  
>PF07960 CBP4:  CBP4;  InterPro: IPR012420 The CBP4 gene in Saccharomyces cerevisiae is essential for the expression and activity of ubiquinol-cytochrome c reductase [, ]. This family appears to be fungal specific. 
Probab=17.86  E-value=65  Score=27.27  Aligned_cols=11  Identities=36%  Similarity=0.691  Sum_probs=9.8

Q ss_pred             CCChHHHHHHH
Q 047622           15 QPSDELLVQFY   25 (300)
Q Consensus        15 ~PTDeELV~~Y   25 (300)
                      .||||||+..|
T Consensus        30 tPTeEeL~~r~   40 (128)
T PF07960_consen   30 TPTEEELFKRY   40 (128)
T ss_pred             CCCHHHHHHhc
Confidence            89999999865


No 5  
>smart00265 BH4 BH4 Bcl-2 homology region 4.
Probab=16.77  E-value=1.5e+02  Score=18.38  Aligned_cols=19  Identities=26%  Similarity=0.205  Sum_probs=15.4

Q ss_pred             ChHHHHHHHHhhhhcCCCC
Q 047622           17 SDELLVQFYLFNKISGTPA   35 (300)
Q Consensus        17 TDeELV~~YL~~Ki~g~~l   35 (300)
                      +-.|||.+|+.-|+..+..
T Consensus         4 ~nRelV~~yv~yKLsQrgy   22 (27)
T smart00265        4 DNRELVVDYVTYKLSQNGY   22 (27)
T ss_pred             chHHHHHHHHHHHHhhcCC
Confidence            5579999999999976544


No 6  
>PRK02079 pyrroloquinoline quinone biosynthesis protein PqqD; Provisional
Probab=16.68  E-value=79  Score=24.78  Aligned_cols=15  Identities=33%  Similarity=0.505  Sum_probs=11.9

Q ss_pred             CCCCCCCCCCCCeeC
Q 047622            1 MERTRPPLPLGCKFQ   15 (300)
Q Consensus         1 M~~~~~~LPpGfRF~   15 (300)
                      |..+.|.||+||||+
T Consensus         1 ~~~~~p~l~~~~rl~   15 (88)
T PRK02079          1 DRNQVPTLRPGYRFQ   15 (88)
T ss_pred             CCCCCcccCCCcccc
Confidence            345678999999987


No 7  
>PF11285 DUF3086:  Protein of unknown function (DUF3086);  InterPro: IPR021437  This family of proteins with unknown function appears to be restricted to Cyanobacteria. 
Probab=14.10  E-value=21  Score=33.69  Aligned_cols=25  Identities=44%  Similarity=0.869  Sum_probs=16.0

Q ss_pred             ccCCCCccchhhhcCCCCCCCCCceEE
Q 047622           47 LYGFKEPWQIWRQFGGPDLEDGEDLYF   73 (300)
Q Consensus        47 vY~~~~PwdLp~~~~~~~~~~~~ewYF   73 (300)
                      .|+  +||.|-..+.+.....-+.|||
T Consensus       129 yYg--~PWqLRRtfe~~hae~v~~WFF  153 (283)
T PF11285_consen  129 YYG--PPWQLRRTFEPIHAERVEDWFF  153 (283)
T ss_pred             ccC--ChHHHHhcccHHHHHHHHHHHh
Confidence            574  9999987665433333355776


No 8  
>COG3100 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=13.72  E-value=1.2e+02  Score=24.38  Aligned_cols=14  Identities=36%  Similarity=0.532  Sum_probs=11.4

Q ss_pred             eEEEEEEEcCCCCC
Q 047622          154 LVLCRIRKNEDIDQ  167 (300)
Q Consensus       154 ~VLCrI~kk~~~~~  167 (300)
                      -.||-|||+++.++
T Consensus        10 ~mlCaIYkS~kk~~   23 (103)
T COG3100          10 SMLCAIYKSPKKDG   23 (103)
T ss_pred             eeeeeeeecCcCCc
Confidence            46899999998664


No 9  
>smart00707 RPEL Repeat in Drosophila CG10860, human KIAA0680 and C. elegans F26H9.2.
Probab=13.67  E-value=1.2e+02  Score=18.57  Aligned_cols=13  Identities=23%  Similarity=0.253  Sum_probs=10.9

Q ss_pred             CCeeCCChHHHHH
Q 047622           11 GCKFQPSDELLVQ   23 (300)
Q Consensus        11 GfRF~PTDeELV~   23 (300)
                      ...++|+-+|||.
T Consensus         6 kl~~RP~~eeLv~   18 (26)
T smart00707        6 KLSQRPTREELEE   18 (26)
T ss_pred             HHHcCCCHHHHHH
Confidence            4568999999997


No 10 
>PRK14390 hypothetical protein; Provisional
Probab=13.33  E-value=1.1e+02  Score=22.77  Aligned_cols=20  Identities=25%  Similarity=0.293  Sum_probs=15.6

Q ss_pred             CCCCCCCCCeeCCChHHHHH
Q 047622            4 TRPPLPLGCKFQPSDELLVQ   23 (300)
Q Consensus         4 ~~~~LPpGfRF~PTDeELV~   23 (300)
                      .++-+|+-+||.||=.|=-.
T Consensus         9 iSp~~~~~CRf~PTCS~Ya~   28 (63)
T PRK14390          9 FSPFFGPRCRFIPSCSSYGY   28 (63)
T ss_pred             hCCCCCCCCCcCccHHHHHH
Confidence            46778999999999766443


Done!