Citrus Sinensis ID: 047642

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------72

MAEAAVLYAVQRLSDLLTQEAVFLQGVRGEVLWLQRELTRMQGFLKDTDQQQDTDDGVRRWVSEVRNAAYDAEDIVDTFMVQPADGGGFWASLKKYACILNRGVNHYGVGKDIEELKGRIIDISRGAEAYGIRTISCTERNRSLTERFRHIRRTSSNAGNEQVVGFEENTKMLIKQLLKDEQQRFVISILGMGGLGKTTLARKLVNSTDVKGGFDCRAWVCVTQEYTTRDLLQKTIKSFQKPKIEDLELMERMTEEDLELHLYEFLEGRRYLVVVDDIWHKSAWESLRRAFPDNGNGSRIVITTRNEPVAMITDEKNFVYKLRFLNQEESWKLFCKKAFPDTADGQATVCSPGLEKLGREMVEKCREEIPHEWHTVKNHLWWHLTQDSDHVSPILALSYDELPYQLKSCFLYLSLFPEDSLIDTEKLIRLWIAEGFIPEEEQDMENVAEEYLKELIDRSMIQIAERYLDKVKTCRIHDLIRELAIKKARALEFLDVYDGKVNLSYSSTSLTRRQVIPSGNMKYVSLVHFYPRLRSLLFFNPDRESINIKHLQTLCSSLRFLRVLDLEDTRIEHSGKVLRLTDSIGKLIHLRYFGFKCNSLVEFPRSIGNLQCLKTMVASGNSCWKLPSQISKLHQLRHLIARPLGHLQVSTLTNLQTLKYVNFQQWDAVDARNLINLQELEIREIPYTNMNFILQVNSLRSLTLQTDTAFNTLLPLSR

cHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccCCccccHHHHHHHHHccccccEEEEEEccccccHHHHHHHHcccccccccccEEEEEEEcccccHHHHHHHHHHHccccccccHHHHHHccHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHccccccccEEEEEcccHHHHHcccccccEEEcccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccHHHHHHcccccccccHHHHHHHcccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccEEEEEEEccEEEEEEEcHHHHHHHHHHHHHcccEEEEcccccccccccccEEEEEEEcccccccccccccccccEEEEEccccccccHHHHHHHcccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccHHHcccccccEEEcccccccccccccccccccccccccccHHHHcccccccEEEECcccccccHHHHcccccccEEEEccccccccccccc

MAEAAVLYAVQRLSDLLTQEAVFLQGVRGEVLWLQRELTRMQGFLKDTDQQQDTDDGVRRWVSEVRNAAYDAEDIVDTFMVQPADGGGFWASLKKYACILNRGVNHYGVGKDIEELKGRIIDISRGAEAYGIRTI*************RH*RRTSSNAGNEQVVGFEENTKMLIKQLLKDEQQRFVISILGMGGLGKTTLARKLVNSTDVKGGFDCRAWVCVTQEYTTRDLLQKTIKSFQKPKIEDLELMERMTEEDLELHLYEFLEGRRYLVVVDDIWHKSAWESLRRAFPDNGNGSRIVITTRNEPVAMITDEKNFVYKLRFLNQEESWKLFCKKAFPDTADGQATVCSPGLEKLGREMVEKCREEIPHEWHTVKNHLWWHLTQDSDHVSPILALSYDELPYQLKSCFLYLSLFPEDSLIDTEKLIRLWIAEGFIPEEEQDMENVAEEYLKELIDRSMIQIAERYLDKVKTCRIHDLIRELAIKKARALEFLDVYDGKVNLSYSSTSLTRRQVIPSGNMKYVSLVHFYPRLRSLLFFNPDRESINIKHLQTLCSSLRFLRVLDLEDTRIEHSGKVLRLTDSIGKLIHLRYFGFKCNSLVEFPRSIGNLQCLKTMVASGNSCWKLPSQISKLHQLRHLIARPLGHLQVSTLTNLQTLKYVNFQQWDAVDARNLINLQELEIREIPYTNMNFILQVNSLRSLTLQTDTAFNTLLPLS*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Disease resistance protein RPP13	Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. In contrast to other resistance proteins, it works independently of ESD1 and NSD1 proteins and does not require the accumulation of salicylic acid, suggesting the existence of an independent signaling pathway. The specificity to avirulence proteins differs in the different cultivars.	probable	Q9M667

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 508-714
View the alignment between query and template
View the model in PyMOL

Template: 2A5Y, chain B
Confidence level:very confident
Coverage over the Query: 164-493
View the alignment between query and template
View the model in PyMOL

Template: 3QFL, chain A
Confidence level:very confident
Coverage over the Query: 4-109
View the alignment between query and template
View the model in PyMOL

Template: 1FNN, chain A
Confidence level:confident
Coverage over the Query: 161-489
View the alignment between query and template
View the model in PyMOL