Query         047650
Match_columns 75
No_of_seqs    134 out of 968
Neff          6.8 
Searched_HMMs 46136
Date          Fri Mar 29 13:16:31 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/047650.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/047650hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN03210 Resistant to P. syrin  99.9 1.5E-28 3.3E-33  194.9   5.8   72    1-74     83-155 (1153)
  2 PLN03194 putative disease resi  99.9 6.5E-23 1.4E-27  137.3   5.0   58    1-74     98-156 (187)
  3 PF01582 TIR:  TIR domain;  Int  99.0 5.1E-11 1.1E-15   75.2   0.8   63    1-63     72-140 (141)
  4 smart00255 TIR Toll - interleu  98.6 2.4E-07 5.3E-12   57.4   5.9   66    1-67     72-139 (140)
  5 KOG2792 Putative cytochrome C   82.6     1.3 2.9E-05   31.7   2.6   27    1-27    155-186 (280)
  6 TIGR02453 conserved hypothetic  65.9     9.4  0.0002   26.1   3.3   55   17-74     94-152 (217)
  7 cd01241 PH_Akt Akt pleckstrin   65.5     6.8 0.00015   23.3   2.3   17   50-66     86-102 (102)
  8 PF12128 DUF3584:  Protein of u  65.5     1.4   3E-05   36.7  -0.9   18   16-33     34-51  (1201)
  9 cd01251 PH_centaurin_alpha Cen  57.7      13 0.00029   22.1   2.6   19   50-68     84-102 (103)
 10 COG0059 IlvC Ketol-acid reduct  57.3     9.8 0.00021   28.0   2.3   59    1-62    229-310 (338)
 11 cd01219 PH_FGD FGD (faciogenit  57.1      12 0.00027   22.1   2.4   18   50-67     83-100 (101)
 12 KOG1136 Predicted cleavage and  55.6     9.9 0.00021   28.7   2.1   19    5-23    222-241 (501)
 13 smart00233 PH Pleckstrin homol  55.6      15 0.00033   19.6   2.5   17   50-66     85-101 (102)
 14 TIGR00295 conserved hypothetic  55.4      27  0.0006   22.5   4.0   33   36-68    131-163 (164)
 15 cd01266 PH_Gab Gab (Grb2-assoc  53.3      15 0.00032   21.9   2.4   17   50-66     92-108 (108)
 16 PF00169 PH:  PH domain;  Inter  53.0      18  0.0004   19.8   2.6   17   50-66     87-103 (104)
 17 cd01260 PH_CNK Connector enhan  52.7      15 0.00032   21.1   2.2   16   50-65     81-96  (96)
 18 KOG1233 Alkyl-dihydroxyacetone  51.8      13 0.00028   28.7   2.2   22    1-22    169-191 (613)
 19 PF07756 DUF1612:  Protein of u  51.6      16 0.00034   23.5   2.3   20   51-70      9-28  (128)
 20 cd01238 PH_Tec Tec pleckstrin   51.1      16 0.00034   21.9   2.2   16   50-65     91-106 (106)
 21 cd01246 PH_oxysterol_bp Oxyste  49.8      18 0.00039   20.0   2.2   16   50-65     76-91  (91)
 22 PF10579 Rapsyn_N:  Rapsyn N-te  49.2      13 0.00027   22.0   1.5   20   51-70     22-41  (80)
 23 cd01235 PH_SETbf Set binding f  48.7      20 0.00044   20.5   2.4   16   50-65     85-100 (101)
 24 PRK05225 ketol-acid reductoiso  46.1       9 0.00019   29.6   0.7   58    1-64    253-335 (487)
 25 COG1904 UxaC Glucuronate isome  45.7      26 0.00055   27.0   3.0   67    3-69    324-400 (463)
 26 PRK10072 putative transcriptio  44.0      20 0.00044   21.6   1.9   59    2-60      7-68  (96)
 27 cd00821 PH Pleckstrin homology  42.8      25 0.00055   18.5   2.1   16   50-65     81-96  (96)
 28 cd01250 PH_centaurin Centaurin  42.5      24 0.00052   19.6   2.0   15   50-64     79-93  (94)
 29 cd00900 PH-like Pleckstrin hom  42.2      26 0.00056   18.6   2.1   16   50-65     84-99  (99)
 30 PF15409 PH_8:  Pleckstrin homo  42.1      28 0.00061   20.8   2.3   15   51-65     74-88  (89)
 31 PF03429 MSP1b:  Major surface   42.0      26 0.00056   27.5   2.5   46   18-68    207-253 (726)
 32 cd01244 PH_RasGAP_CG9209 RAS_G  40.4      27 0.00059   20.9   2.1   16   50-65     83-98  (98)
 33 cd01252 PH_cytohesin Cytohesin  40.3      32  0.0007   20.9   2.4   18   50-67     97-114 (125)
 34 cd01230 PH_EFA6 EFA6 Pleckstri  40.1      31 0.00067   21.4   2.3   19   50-68     95-113 (117)
 35 PF09838 DUF2065:  Uncharacteri  39.5      26 0.00055   19.2   1.7   17   56-72     21-37  (57)
 36 PF01320 Colicin_Pyocin:  Colic  38.5      26 0.00057   20.8   1.7   15   53-71     69-83  (85)
 37 PHA03068 DNA-binding phosphopr  36.9      31 0.00068   24.7   2.2   23    2-24    175-200 (270)
 38 COG1999 Uncharacterized protei  36.8      50  0.0011   22.2   3.1   38    2-39     87-127 (207)
 39 PHA00407 phage lambda Rz1-like  36.6      25 0.00055   20.8   1.4   23   51-73     24-51  (84)
 40 PF15410 PH_9:  Pleckstrin homo  35.5      44 0.00095   20.3   2.5   17   50-66    102-118 (119)
 41 COG1782 Predicted metal-depend  33.8      38 0.00082   26.9   2.3   20    3-22    395-416 (637)
 42 cd01040 globin Globins are hem  33.5   1E+02  0.0023   18.0   4.0   33   36-68    104-139 (140)
 43 PRK05422 smpB SsrA-binding pro  33.2      44 0.00095   21.9   2.3   33    3-35     86-119 (148)
 44 PF13676 TIR_2:  TIR domain; PD  33.0      34 0.00075   19.5   1.7   25    1-30     67-91  (102)
 45 PRK02797 4-alpha-L-fucosyltran  32.0 1.2E+02  0.0026   22.4   4.5   17   51-67    303-319 (322)
 46 cd01263 PH_anillin Anillin Ple  31.7      42 0.00092   21.0   2.0   16   50-65    107-122 (122)
 47 TIGR00086 smpB SsrA-binding pr  31.1      49  0.0011   21.6   2.2   33    3-35     82-116 (144)
 48 COG1155 NtpA Archaeal/vacuolar  30.9      56  0.0012   25.9   2.9   34   37-70    312-345 (588)
 49 PF15043 CNRIP1:  CB1 cannabino  30.7      23 0.00051   23.5   0.7    7   20-26     22-28  (161)
 50 KOG4116 Ubiquinol cytochrome c  30.5      56  0.0012   19.7   2.2   29   21-49     22-50  (90)
 51 cd00153 RalGDS_RA Ubiquitin do  30.1      37 0.00081   20.4   1.4   15   14-28     59-77  (87)
 52 KOG2865 NADH:ubiquinone oxidor  29.9      28  0.0006   25.9   1.0   27   12-40     83-111 (391)
 53 PF04661 Pox_I3:  Poxvirus I3 s  29.4      44 0.00095   23.9   1.9   23    2-24    165-190 (262)
 54 cd01233 Unc104 Unc-104 pleckst  28.7      61  0.0013   18.9   2.3   16   50-65     82-97  (100)
 55 PF12006 DUF3500:  Protein of u  28.3      36 0.00079   24.5   1.4   20   16-35    143-162 (313)
 56 cd01265 PH_PARIS-1 PARIS-1 ple  27.8      69  0.0015   18.6   2.4   16   50-65     78-93  (95)
 57 cd01257 PH_IRS Insulin recepto  27.8      63  0.0014   19.4   2.2   16   50-65     86-101 (101)
 58 PF10657 RC-P840_PscD:  Photosy  26.9      27 0.00058   22.6   0.5    9   17-25    115-123 (144)
 59 PF02630 SCO1-SenC:  SCO1/SenC;  26.8      66  0.0014   20.7   2.4   40    2-41     72-113 (174)
 60 PF08921 DUF1904:  Domain of un  26.8      45 0.00098   20.5   1.5   19    2-20     22-42  (108)
 61 COG2719 SpoVR Uncharacterized   26.2      76  0.0017   24.6   2.8   43    6-48     20-75  (495)
 62 PF07521 RMMBL:  RNA-metabolisi  26.1      77  0.0017   15.9   2.1   17    3-21     21-38  (43)
 63 smart00692 DM3 Zinc finger dom  26.1      61  0.0013   17.1   1.8   16   48-63      4-19  (59)
 64 COG1956 GAF domain-containing   26.0      41  0.0009   22.4   1.3   15   12-26    112-126 (163)
 65 KOG2540 Cytochrome oxidase ass  26.0      33 0.00071   24.3   0.8   18   15-32    213-230 (269)
 66 PRK09857 putative transposase;  25.6      61  0.0013   23.0   2.1   25    6-30    100-132 (292)
 67 PRK02925 glucuronate isomerase  25.2 1.4E+02   0.003   23.1   4.0   65    4-69    327-402 (466)
 68 PF03641 Lysine_decarbox:  Poss  25.0      77  0.0017   19.6   2.3   25    2-26     67-93  (133)
 69 cd01253 PH_beta_spectrin Beta-  24.8      72  0.0016   18.4   2.1   15   50-64     89-103 (104)
 70 PF07386 DUF1499:  Protein of u  24.6      46 0.00099   20.3   1.2   15   49-63    104-118 (118)
 71 PF05485 THAP:  THAP domain;  I  24.2      68  0.0015   17.8   1.8   19   49-67     24-42  (84)
 72 PF15411 PH_10:  Pleckstrin hom  24.1      46 0.00099   20.6   1.1   12   51-62    105-116 (116)
 73 cd01247 PH_GPBP Goodpasture an  23.9      84  0.0018   18.2   2.2   15   50-64     76-90  (91)
 74 KOG4302 Microtubule-associated  23.7 1.6E+02  0.0036   23.7   4.3   63   12-74    139-202 (660)
 75 COG0124 HisS Histidyl-tRNA syn  23.5      51  0.0011   25.0   1.5   27    2-33    241-268 (429)
 76 cd03063 TRX_Fd_FDH_beta TRX-li  23.4      28 0.00061   20.8   0.1   12   21-32     60-72  (92)
 77 PTZ00240 60S ribosomal protein  23.3      83  0.0018   23.0   2.5   50   15-69    184-233 (323)
 78 PF04333 VacJ:  VacJ like lipop  23.0      48   0.001   22.6   1.1   27   14-43    118-144 (200)
 79 cd06418 GH25_BacA-like BacA is  22.9 1.5E+02  0.0032   20.1   3.5   22    4-28     57-78  (212)
 80 PF15413 PH_11:  Pleckstrin hom  22.6      98  0.0021   18.6   2.4   16   50-65     97-112 (112)
 81 cd01237 Unc112 Unc-112 pleckst  22.6      98  0.0021   19.1   2.4   17   50-66     87-103 (106)
 82 cd01236 PH_outspread Outspread  22.4      91   0.002   18.9   2.2   15   50-64     88-102 (104)
 83 TIGR00702 uncharacterized doma  21.9      30 0.00064   25.4  -0.0   15   17-31     31-45  (377)
 84 PF01041 DegT_DnrJ_EryC1:  DegT  21.7      47   0.001   23.6   1.0   16   18-33     87-102 (363)
 85 PF12515 CaATP_NAI:  Ca2+-ATPas  21.7 1.1E+02  0.0025   16.2   2.2   15   51-65     14-28  (47)
 86 KOG2941 Beta-1,4-mannosyltrans  21.5      44 0.00096   25.4   0.8    8    1-8     375-382 (444)
 87 PF09365 DUF2461:  Conserved hy  21.1 1.4E+02  0.0031   20.2   3.2   48   17-67     93-144 (212)
 88 cd01220 PH_CDEP Chondrocyte-de  20.9 1.2E+02  0.0025   18.1   2.4   18   50-67     81-98  (99)
 89 PF12612 TFCD_C:  Tubulin foldi  20.8      63  0.0014   21.2   1.4   21    2-22    129-150 (193)
 90 PF07964 Red1:  Rec10 / Red1;    20.8 1.2E+02  0.0026   24.7   3.1   41   30-70    654-694 (706)
 91 COG1236 YSH1 Predicted exonucl  20.6      80  0.0017   23.6   2.0   20    5-24    205-226 (427)
 92 PHA03269 envelope glycoprotein  20.5      19 0.00041   28.2  -1.3   50   11-61    162-219 (566)
 93 PF05678 VQ:  VQ motif;  InterP  20.5      32 0.00069   16.6  -0.1   13   19-31      4-16  (31)
 94 PF11004 Kdo_hydroxy:  3-deoxy-  20.3      70  0.0015   23.1   1.6   36   13-49    137-172 (281)
 95 TIGR03675 arCOG00543 arCOG0054  20.3      83  0.0018   24.9   2.1   20    3-22    389-410 (630)
 96 PF12646 DUF3783:  Domain of un  20.1 1.3E+02  0.0028   16.1   2.3   28    3-31     12-40  (58)

No 1  
>PLN03210 Resistant to P. syringae 6; Provisional
Probab=99.95  E-value=1.5e-28  Score=194.86  Aligned_cols=72  Identities=43%  Similarity=0.696  Sum_probs=68.1

Q ss_pred             ChHHHHHHHhh-hcCCCeeeeeeeecccCcceeccchHHHHHHHhHHhhccCHHHHHHHHHHHHHhhcccccccc
Q 047650            1 CLDELLKIVEC-KNRKNQNFPTFNDVEPTIVRKQTTTFGEAFAKHEEFFKDNIKKVQNWRQALKVVANISGWELR   74 (75)
Q Consensus         1 CLdEL~~I~e~-~~~~~~ViPVFY~V~ps~Vr~q~g~f~~~f~~~~~~~~~~~e~v~~W~~AL~~va~~~G~~~~   74 (75)
                      |||||++|+|| ++.+++|+||||+|+|||||+|+|.||++|.+++++.  +.+++++||+||++||+++||+++
T Consensus        83 cl~el~~i~~~~~~~~~~v~pvfy~v~p~~v~~~~g~f~~~f~~~~~~~--~~~~~~~w~~al~~~~~~~g~~~~  155 (1153)
T PLN03210         83 CLNELLEIVRCKEELGQLVIPVFYGLDPSHVRKQTGDFGEAFEKTCQNK--TEDEKIQWKQALTDVANILGYHSQ  155 (1153)
T ss_pred             HHHHHHHHHHhhhhcCceEEEEEecccHHHHhhccchHHHHHHHHhccc--chhHHHHHHHHHHHHhCcCceecC
Confidence            99999999999 9999999999999999999999999999999988754  478999999999999999999875


No 2  
>PLN03194 putative disease resistance protein; Provisional
Probab=99.87  E-value=6.5e-23  Score=137.34  Aligned_cols=58  Identities=29%  Similarity=0.450  Sum_probs=51.1

Q ss_pred             ChHHHHHHHhhhcCCCeeeeeeeecccCcceec-cchHHHHHHHhHHhhccCHHHHHHHHHHHHHhhcccccccc
Q 047650            1 CLDELLKIVECKNRKNQNFPTFNDVEPTIVRKQ-TTTFGEAFAKHEEFFKDNIKKVQNWRQALKVVANISGWELR   74 (75)
Q Consensus         1 CLdEL~~I~e~~~~~~~ViPVFY~V~ps~Vr~q-~g~f~~~f~~~~~~~~~~~e~v~~W~~AL~~va~~~G~~~~   74 (75)
                      |||||++|++|   +..||||||+|+|||||+| .|.             .+.+++++||.||++||+++||+++
T Consensus        98 CLdEL~~I~e~---~~~ViPIFY~VdPsdVr~q~~~~-------------~~~e~v~~Wr~AL~~va~l~G~~~~  156 (187)
T PLN03194         98 CLHELALIMES---KKRVIPIFCDVKPSQLRVVDNGT-------------CPDEEIRRFNWALEEAKYTVGLTFD  156 (187)
T ss_pred             HHHHHHHHHHc---CCEEEEEEecCCHHHhhccccCC-------------CCHHHHHHHHHHHHHHhccccccCC
Confidence            99999999998   3479999999999999997 543             1368999999999999999999764


No 3  
>PF01582 TIR:  TIR domain;  InterPro: IPR000157 In Drosophila melanogaster the Toll protein is involved in establishment of dorso-ventral polarity in the embryo. In addition, members of the Toll family play a key role in innate antibacterial and antifungal immunity in insects as well as in mammals. These proteins are type-I transmembrane receptors that share an intracellular 200 residue domain with the interleukin-1 receptor (IL-1R), the Toll/IL-1R homologous region (TIR). The similarity between Toll-like receptors (LTRs) and IL-1R is not restricted to sequence homology since these proteins also share a similar signalling pathway. They both induce the activation of a Rel type transcription factor via an adaptor protein and a protein kinase []. Interestingly, MyD88, a cytoplasmic adaptor protein found in mammals, contains a TIR domain associated to a DEATH domain (see IPR000488 from INTERPRO) [, , ]. Besides the mammalian and Drosophila melanogaster proteins, a TIR domain is also found in a number of plant proteins implicated in host defence []. As MyD88, these proteins are cytoplasmic. Site directed mutagenesis and deletion analysis have shown that the TIR domain is essential for Toll and IL-1R activities. Sequence analysis have revealed the presence of three highly conserved regions among the different members of the family: box 1 (FDAFISY), box 2 (GYKLC-RD-PG), and box 3 (a conserved W surrounded by basic residues). It has been proposed that boxes 1 and 2 are involved in the binding of proteins involved in signalling, whereas box 3 is primarily involved in directing localization of receptor, perhaps through interactions with cytoskeletal elements [].; GO: 0005515 protein binding, 0007165 signal transduction, 0005622 intracellular; PDB: 3J0A_A 2J67_B 3JRN_A 1FYV_A 1O77_D 1FYX_A 1FYW_A 3OZI_B 1T3G_B 2JS7_A ....
Probab=99.04  E-value=5.1e-11  Score=75.22  Aligned_cols=63  Identities=27%  Similarity=0.369  Sum_probs=53.1

Q ss_pred             ChHHHHHHHhh-hcCC--CeeeeeeeecccCcce-eccchHHHHHHHhHHhhccC--HHHHHHHHHHHH
Q 047650            1 CLDELLKIVEC-KNRK--NQNFPTFNDVEPTIVR-KQTTTFGEAFAKHEEFFKDN--IKKVQNWRQALK   63 (75)
Q Consensus         1 CLdEL~~I~e~-~~~~--~~ViPVFY~V~ps~Vr-~q~g~f~~~f~~~~~~~~~~--~e~v~~W~~AL~   63 (75)
                      |+.||..++++ .+.+  ++|+||||+|.|++|+ .+++.|+..|..+......+  .++...|++++.
T Consensus        72 c~~el~~a~~~~~~~~~~~~Il~v~~~v~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~fW~~l~~  140 (141)
T PF01582_consen   72 CLFELQEALERLLEEGRDKLILPVFYDVSPSDVRPDQSLRFLLRFLTYLRWPDDDSREDRSWFWKKLRY  140 (141)
T ss_dssp             HHHHHHHHHHHHHCSTCTTEEEEESSSS-CHHCHTHHHHHHHHHCTHCEETSSSGGGGGHHHHHHHHHH
T ss_pred             hhhhhhhhhhhccccccccceeeEeccCChhhcChhhhHHHHHHhhhheeCCCCCCccHHHHHHHHHhc
Confidence            89999999999 6654  8999999999999999 79999999998877655433  468899999975


No 4  
>smart00255 TIR Toll - interleukin 1 - resistance.
Probab=98.56  E-value=2.4e-07  Score=57.36  Aligned_cols=66  Identities=32%  Similarity=0.507  Sum_probs=54.0

Q ss_pred             ChHHHHHHHhh-hc-CCCeeeeeeeecccCcceeccchHHHHHHHhHHhhccCHHHHHHHHHHHHHhhc
Q 047650            1 CLDELLKIVEC-KN-RKNQNFPTFNDVEPTIVRKQTTTFGEAFAKHEEFFKDNIKKVQNWRQALKVVAN   67 (75)
Q Consensus         1 CLdEL~~I~e~-~~-~~~~ViPVFY~V~ps~Vr~q~g~f~~~f~~~~~~~~~~~e~v~~W~~AL~~va~   67 (75)
                      |..|+..+.++ .. ....||||+|+..|+++..+.+.++..+..+...+..+..+ ..|+.++..+++
T Consensus        72 ~~~E~~~a~~~~~~~~~~~iIPI~~~~~~~~~~~~~~~l~~~~~~~~~~w~~~~~~-~fW~~~~~~l~~  139 (140)
T smart00255       72 CLDELVAALENALEEGGLRVIPIFYEVIPSDVRKQPGKFRKVLKKNYLKWPEDEKE-RFWKKALYAVPS  139 (140)
T ss_pred             HHHHHHHHHHHHHHcCCCeEEEEEEecChHHHHhcccHHHHHHHHHHhhcCCchhH-HHHHHHHHHhcc
Confidence            78899999998 44 67899999999999999999999999998875445433333 789999988764


No 5  
>KOG2792 consensus Putative cytochrome C oxidase assembly protein [Energy production and conversion]
Probab=82.63  E-value=1.3  Score=31.68  Aligned_cols=27  Identities=33%  Similarity=0.525  Sum_probs=21.8

Q ss_pred             ChHHHHHHHhh-----hcCCCeeeeeeeeccc
Q 047650            1 CLDELLKIVEC-----KNRKNQNFPTFNDVEP   27 (75)
Q Consensus         1 CLdEL~~I~e~-----~~~~~~ViPVFY~V~p   27 (75)
                      |=|||.||..-     .+.+..++|||--|||
T Consensus       155 CPdELeKm~~~Vd~i~~~~~~~~~PlFIsvDP  186 (280)
T KOG2792|consen  155 CPDELEKMSAVVDEIEAKPGLPPVPLFISVDP  186 (280)
T ss_pred             ChHHHHHHHHHHHHHhccCCCCccceEEEeCc
Confidence            78899887764     3556778899999999


No 6  
>TIGR02453 conserved hypothetical protein TIGR02453. Members of this family are widely (though sparsely) distributed bacterial proteins about 230 residues in length. All members have a motif RxxRDxRFxxx[DN]KxxY. The function of this protein family is unknown. In several fungi, this model identifies a conserved region of a longer protein. Therefore, it may be incorrect to speculate that all members share a common function.
Probab=65.92  E-value=9.4  Score=26.11  Aligned_cols=55  Identities=18%  Similarity=0.356  Sum_probs=35.9

Q ss_pred             eeeeeee-ecccCcceeccchHH---HHHHHhHHhhccCHHHHHHHHHHHHHhhcccccccc
Q 047650           17 QNFPTFN-DVEPTIVRKQTTTFG---EAFAKHEEFFKDNIKKVQNWRQALKVVANISGWELR   74 (75)
Q Consensus        17 ~ViPVFY-~V~ps~Vr~q~g~f~---~~f~~~~~~~~~~~e~v~~W~~AL~~va~~~G~~~~   74 (75)
                      .--|.|| +|+|....--.|.|.   +.+....+...   +....|+.+|.......||.+.
T Consensus        94 ~~~~gyY~hi~p~~~~~g~G~~~p~~~~L~~iR~~I~---~~~~~~~~il~~~~~~~~f~~~  152 (217)
T TIGR02453        94 LEAPGFYLHLQPDGSFAGGGLWGPEAETLAAVRAAIA---ENPDGWKAAVAALKFLRGFPLS  152 (217)
T ss_pred             CCCceEEEEEcCCCeEEEEEeCCCCHHHHHHHHHHHH---hCHHHHHHHHhChhhhccCCCC
Confidence            4467776 899998877777664   44444444443   3347888888777765666543


No 7  
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain. Akt pleckstrin homology (PH) domain.  Akt (Protein Kinase B (PKB)) is a phosphatidylinositol 3'-kinase (PI3K)-dependent Ser/Thr kinase. The PH domain recruits Akt to the plasma membrane by binding to phosphoinositides (PtdIns-3,4-P2) and is required for activation. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=65.54  E-value=6.8  Score=23.29  Aligned_cols=17  Identities=24%  Similarity=0.579  Sum_probs=14.4

Q ss_pred             cCHHHHHHHHHHHHHhh
Q 047650           50 DNIKKVQNWRQALKVVA   66 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~va   66 (75)
                      ++.+.++.|..||..|+
T Consensus        86 ~s~ee~~eWi~ai~~v~  102 (102)
T cd01241          86 ESPEEREEWIHAIQTVA  102 (102)
T ss_pred             CCHHHHHHHHHHHHhhC
Confidence            46789999999998874


No 8  
>PF12128 DUF3584:  Protein of unknown function (DUF3584);  InterPro: IPR021979  This family consist of uncharacterised bacterial proteins. 
Probab=65.49  E-value=1.4  Score=36.71  Aligned_cols=18  Identities=17%  Similarity=0.331  Sum_probs=15.1

Q ss_pred             CeeeeeeeecccCcceec
Q 047650           16 NQNFPTFNDVEPTIVRKQ   33 (75)
Q Consensus        16 ~~ViPVFY~V~ps~Vr~q   33 (75)
                      +..||+||+-+|+.|-..
T Consensus        34 LRlip~FYGa~p~rlv~k   51 (1201)
T PF12128_consen   34 LRLIPFFYGADPSRLVPK   51 (1201)
T ss_pred             HHHHHHhcCCCccccCCc
Confidence            578999999999998443


No 9  
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain. Centaurin alpha Pleckstrin homology (PH) domain. Centaurin alpha is a phophatidlyinositide binding protein consisting of an N-terminal ArfGAP domain and two PH domains. In response to growth factor activation, PI3K phosphorylates phosphatidylinositol 4,5-bisphosphate to phosphatidylinositol 3,4,5-trisphosphate. Centaurin alpha 1 is recruited to the plasma membrane following growth factor stimulation by specific binding of its PH domain to phosphatidylinositol 3,4,5-trisphosphate. Centaurin alpha 2 is constitutively bound to the plasma membrane since it binds phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate with equal affinity. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specifici
Probab=57.70  E-value=13  Score=22.09  Aligned_cols=19  Identities=16%  Similarity=0.333  Sum_probs=16.1

Q ss_pred             cCHHHHHHHHHHHHHhhcc
Q 047650           50 DNIKKVQNWRQALKVVANI   68 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~va~~   68 (75)
                      ++.+....|.+||..|-+.
T Consensus        84 ~s~~e~~~Wi~ai~~v~~~  102 (103)
T cd01251          84 ETEQDRREWIAAFQNVLSR  102 (103)
T ss_pred             CCHHHHHHHHHHHHHHhcC
Confidence            5688899999999998764


No 10 
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism]
Probab=57.34  E-value=9.8  Score=28.04  Aligned_cols=59  Identities=20%  Similarity=0.293  Sum_probs=36.7

Q ss_pred             ChHHHHHHHhh-hcCC----------------Ceeee-eeeecccCccee-----ccchHHHHHHHhHHhhccCHHHHHH
Q 047650            1 CLDELLKIVEC-KNRK----------------NQNFP-TFNDVEPTIVRK-----QTTTFGEAFAKHEEFFKDNIKKVQN   57 (75)
Q Consensus         1 CLdEL~~I~e~-~~~~----------------~~ViP-VFY~V~ps~Vr~-----q~g~f~~~f~~~~~~~~~~~e~v~~   57 (75)
                      ||+||..|++. -+.|                .+.-| |+=...+..+++     |+|.|.+.|..-.+.   ...++.+
T Consensus       229 ~lhE~klIvdLiyegGi~~M~~siSnTAeyG~~~~gprii~~~~k~~mk~~l~dIq~G~Fak~~~~e~~~---g~p~l~~  305 (338)
T COG0059         229 CLHELKLIVDLIYEGGITNMRYSISNTAEYGDYTRGPRIIDAETKEEMKKVLKDIQSGEFAKEWILENQA---GRPKLEA  305 (338)
T ss_pred             HHHHHHHHHHHHHHhhHHHHHHhcCCHHHhcccccCceeecHHhHHHHHHHHHHHhcChhHHHHHHhhhc---CCHHHHH
Confidence            78999998887 4443                45566 333333444443     789999888754432   2456777


Q ss_pred             HHHHH
Q 047650           58 WRQAL   62 (75)
Q Consensus        58 W~~AL   62 (75)
                      ||...
T Consensus       306 ~r~~~  310 (338)
T COG0059         306 LREET  310 (338)
T ss_pred             HHHHh
Confidence            76654


No 11 
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain. FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain. FGD has a RhoGEF (DH) domain, followed by a PH domain, a FYVE domain and a C-terminal PH domain. FGD is a guanine nucleotide exchange factor that activates the Rho GTPase Cdc42. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=57.09  E-value=12  Score=22.09  Aligned_cols=18  Identities=22%  Similarity=0.449  Sum_probs=15.4

Q ss_pred             cCHHHHHHHHHHHHHhhc
Q 047650           50 DNIKKVQNWRQALKVVAN   67 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~va~   67 (75)
                      ++++...+|.+||..+.+
T Consensus        83 ~s~eEk~~W~~ai~~~i~  100 (101)
T cd01219          83 RTQKEKNDWVQAIFSIID  100 (101)
T ss_pred             CCHHHHHHHHHHHHHHhh
Confidence            568899999999998864


No 12 
>KOG1136 consensus Predicted cleavage and polyadenylation specificity factor (CPSF subunit) [RNA processing and modification]
Probab=55.63  E-value=9.9  Score=28.73  Aligned_cols=19  Identities=32%  Similarity=0.539  Sum_probs=17.1

Q ss_pred             HHHHHhh-hcCCCeeeeeee
Q 047650            5 LLKIVEC-KNRKNQNFPTFN   23 (75)
Q Consensus         5 L~~I~e~-~~~~~~ViPVFY   23 (75)
                      |.+..|| ..+|.++||||=
T Consensus       222 Lk~VhecVa~GGkvlIPvFA  241 (501)
T KOG1136|consen  222 LKKVHECVARGGKVLIPVFA  241 (501)
T ss_pred             HHHHHHHHhcCCeEEEEeee
Confidence            7788999 999999999993


No 13 
>smart00233 PH Pleckstrin homology domain. Domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids.
Probab=55.55  E-value=15  Score=19.57  Aligned_cols=17  Identities=18%  Similarity=0.466  Sum_probs=14.4

Q ss_pred             cCHHHHHHHHHHHHHhh
Q 047650           50 DNIKKVQNWRQALKVVA   66 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~va   66 (75)
                      .+.+..++|..||..++
T Consensus        85 ~s~~~~~~W~~~i~~~~  101 (102)
T smart00233       85 ESEEEREEWVDALRKAI  101 (102)
T ss_pred             CCHHHHHHHHHHHHHhh
Confidence            46788999999998875


No 14 
>TIGR00295 conserved hypothetical protein TIGR00295. This set of orthologs is narrowly defined, comprising proteins found in three Archaea but not in Pyrococcus horikoshii. The closest homologs are other archaeal proteins that appear to be represent distinct orthologous clusters.
Probab=55.40  E-value=27  Score=22.49  Aligned_cols=33  Identities=21%  Similarity=0.247  Sum_probs=26.2

Q ss_pred             hHHHHHHHhHHhhccCHHHHHHHHHHHHHhhcc
Q 047650           36 TFGEAFAKHEEFFKDNIKKVQNWRQALKVVANI   68 (75)
Q Consensus        36 ~f~~~f~~~~~~~~~~~e~v~~W~~AL~~va~~   68 (75)
                      +-.+-|.+...++..++....+|+.+..++.++
T Consensus       131 ~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  163 (164)
T TIGR00295       131 TIDEVIKKLEERLGKNHPSIERARKLKEELERL  163 (164)
T ss_pred             cHHHHHHHHHHHhCCChHHHHHHHHHHHHHHhh
Confidence            345666677778887888899999999998775


No 15 
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain. Gab (Grb2-associated binder) pleckstrin homology (PH) domain. The Gab subfamily includes several Gab proteins, Drosophila DOS and C. elegans SOC-1. They are scaffolding adaptor proteins, which possess N-terminal PH domains and a C-terminus with proline-rich regions and multiple phosphorylation sites. Following activation of growth factor receptors, Gab proteins are tyrosine phosphorylated and activate PI3K, which generates 3-phosphoinositide lipids. By binding to these lipids via the PH domain, Gab proteins remain in proximity to the receptor, leading to further signaling. While not all Gab proteins depend on the PH domain for recruitment, it is required for Gab activity. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display str
Probab=53.30  E-value=15  Score=21.88  Aligned_cols=17  Identities=12%  Similarity=0.327  Sum_probs=14.7

Q ss_pred             cCHHHHHHHHHHHHHhh
Q 047650           50 DNIKKVQNWRQALKVVA   66 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~va   66 (75)
                      ++.+.++.|..|+.+++
T Consensus        92 ~s~ee~~~Wi~~I~~~~  108 (108)
T cd01266          92 KNEEEMTLWVNCICKLC  108 (108)
T ss_pred             CCHHHHHHHHHHHHhhC
Confidence            57889999999998874


No 16 
>PF00169 PH:  PH domain;  InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ]. The pleckstrin homology domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids. The 3D structure of several PH domains has been determined []. All known cases have a common structure consisting of two perpendicular anti-parallel beta sheets, followed by a C-terminal amphipathic helix. The loops connecting the beta-strands differ greatly in length, making the PH domain relatively difficult to detect. There are no totally invariant residues within the PH domain. Proteins reported to contain one more PH domains belong to the following families:  Pleckstrin, the protein where this domain was first detected, is the major substrate of protein kinase C in platelets. Pleckstrin is one of the rare proteins to contains two PH domains. Ser/Thr protein kinases such as the Akt/Rac family, the beta-adrenergic receptor kinases, the mu isoform of PKC and the trypanosomal NrkA family. Tyrosine protein kinases belonging to the Btk/Itk/Tec subfamily. Insulin Receptor Substrate 1 (IRS-1). Regulators of small G-proteins like guanine nucleotide releasing factor GNRP (Ras-GRF) (which contains 2 PH domains), guanine nucleotide exchange proteins like vav, dbl, SoS and Saccharomyces cerevisiae CDC24, GTPase activating proteins like rasGAP and BEM2/IPL2, and the human break point cluster protein bcr. Cytoskeletal proteins such as dynamin (see IPR001401 from INTERPRO), Caenorhabditis elegans kinesin-like protein unc-104 (see IPR001752 from INTERPRO), spectrin beta-chain, syntrophin (2 PH domains) and S. cerevisiae nuclear migration protein NUM1. Mammalian phosphatidylinositol-specific phospholipase C (PI-PLC) (see IPR000909 from INTERPRO) isoforms gamma and delta. Isoform gamma contains two PH domains, the second one is split into two parts separated by about 400 residues. Oxysterol binding proteins OSBP, S. cerevisiae OSH1 and YHR073w. Mouse protein citron, a putative rho/rac effector that binds to the GTP-bound forms of rho and rac. Several S. cerevisiae proteins involved in cell cycle regulation and bud formation like BEM2, BEM3, BUD4 and the BEM1-binding proteins BOI2 (BEB1) and BOI1 (BOB1). C. elegans protein MIG-10. C. elegans hypothetical proteins C04D8.1, K06H7.4 and ZK632.12. S. cerevisiae hypothetical proteins YBR129c and YHR155w. ; GO: 0005515 protein binding; PDB: 1DYN_B 2DYN_B 3SNH_A 3ZYS_C 1X05_A 2I5F_A 1ZM0_B 1XX0_A 2I5C_C 3A8P_D ....
Probab=52.98  E-value=18  Score=19.76  Aligned_cols=17  Identities=18%  Similarity=0.431  Sum_probs=14.6

Q ss_pred             cCHHHHHHHHHHHHHhh
Q 047650           50 DNIKKVQNWRQALKVVA   66 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~va   66 (75)
                      .+.+....|..||..+.
T Consensus        87 ~s~~~~~~W~~~i~~~~  103 (104)
T PF00169_consen   87 ESEEERKRWIQAIQKAI  103 (104)
T ss_dssp             SSHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHh
Confidence            46889999999999875


No 17 
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras)  (CNK) pleckstrin homology (PH) domain. Connector enhancer of KSR (Kinase suppressor of ras)  (CNK) pleckstrin homology (PH) domain. CNK is believed to regulate the activity and the subcellular localization of RAS activated RAF. CNK is composed of N-terminal SAM and PDZ domains along with a central or C-terminal PH domain.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPAses, adaptors, a well as cytoskelet
Probab=52.74  E-value=15  Score=21.12  Aligned_cols=16  Identities=13%  Similarity=0.497  Sum_probs=13.3

Q ss_pred             cCHHHHHHHHHHHHHh
Q 047650           50 DNIKKVQNWRQALKVV   65 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~v   65 (75)
                      ++.+.+++|..||..+
T Consensus        81 ~s~~e~~~Wi~ai~~~   96 (96)
T cd01260          81 ETLDDLSQWVNHLITA   96 (96)
T ss_pred             CCHHHHHHHHHHHHhC
Confidence            5678999999999764


No 18 
>KOG1233 consensus Alkyl-dihydroxyacetonephosphate synthase [General function prediction only]
Probab=51.82  E-value=13  Score=28.69  Aligned_cols=22  Identities=36%  Similarity=0.501  Sum_probs=19.0

Q ss_pred             ChHHHHHHHhh-hcCCCeeeeee
Q 047650            1 CLDELLKIVEC-KNRKNQNFPTF   22 (75)
Q Consensus         1 CLdEL~~I~e~-~~~~~~ViPVF   22 (75)
                      |-||.|+|++. -+.+..+|||=
T Consensus       169 chdevVkiv~lA~khN~~iiPiG  191 (613)
T KOG1233|consen  169 CHDEVVKIVELAMKHNCAIIPIG  191 (613)
T ss_pred             chHHHHHHHHHHhhcCeEEEEeC
Confidence            88999999999 77788899963


No 19 
>PF07756 DUF1612:  Protein of unknown function (DUF1612);  InterPro: IPR011670 This family includes sequences of largely unknown function but which share a number of features in common. They are expressed by bacterial species, and in many cases these bacteria are known to associate symbiotically with plants. Moreover, the majority are coded for by plasmids, which in many cases are known to confer on the organism the ability to interact symbiotically with leguminous plants. An example of such a plasmid is NGR234, which encodes Y4CF, a protein of unknown function that is a member of this family []. Other members of this family are expressed by organisms with a documented genomic similarity to plant symbionts [].
Probab=51.64  E-value=16  Score=23.46  Aligned_cols=20  Identities=15%  Similarity=0.494  Sum_probs=17.3

Q ss_pred             CHHHHHHHHHHHHHhhcccc
Q 047650           51 NIKKVQNWRQALKVVANISG   70 (75)
Q Consensus        51 ~~e~v~~W~~AL~~va~~~G   70 (75)
                      +.+++..|+..|.++.+++.
T Consensus         9 E~~RL~eWr~vl~~~~~LPp   28 (128)
T PF07756_consen    9 EDERLDEWRAVLREAEALPP   28 (128)
T ss_pred             hHHHHHHHHHHHHHHhhCCH
Confidence            35789999999999998874


No 20 
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain. Tec pleckstrin homology (PH) domain. Proteins in the Tec family of cytoplasmic protein tyrosine kinases that includes Bruton's tyrosine kinase (BTK), BMX, IL2-inducible T-cell kinase (Itk) and Tec. These proteins generally have an N-terminal PH domain, followed by a Tek homology (TH) domain, a SH3 domain, a SH2 domain and a kinase domain. Tec PH domains tether these proteins to membranes following the activation of PI3K and its subsequent phosphorylation of phosphoinositides. The importance of PH domain membrane anchoring is confirmed by the discovery of a mutation of a critical arginine residue in the BTK PH domain, which causes X-linked agammaglobulinemia (XLA) in humans and a related disorder is mice. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few dis
Probab=51.06  E-value=16  Score=21.90  Aligned_cols=16  Identities=31%  Similarity=0.434  Sum_probs=13.7

Q ss_pred             cCHHHHHHHHHHHHHh
Q 047650           50 DNIKKVQNWRQALKVV   65 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~v   65 (75)
                      .+.+..+.|..||..|
T Consensus        91 ~s~~er~~WI~ai~~~  106 (106)
T cd01238          91 PTEELRKRWIKALKQV  106 (106)
T ss_pred             CCHHHHHHHHHHHHhC
Confidence            4678899999999875


No 21 
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain. Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain. Oxysterol binding proteins are a multigene family that is conserved in yeast, flies, worms, mammals and plants. They all contain a C-terminal oxysterol binding domain, and most contain an N-terminal PH domain. OSBP PH domains bind to membrane phosphoinositides and thus likely play an important role in intracellular targeting. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=49.79  E-value=18  Score=19.97  Aligned_cols=16  Identities=25%  Similarity=0.551  Sum_probs=13.2

Q ss_pred             cCHHHHHHHHHHHHHh
Q 047650           50 DNIKKVQNWRQALKVV   65 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~v   65 (75)
                      ++.+...+|..||..+
T Consensus        76 ~s~~e~~~Wi~al~~a   91 (91)
T cd01246          76 NSEEERQRWVDALELA   91 (91)
T ss_pred             CCHHHHHHHHHHHHhC
Confidence            4678899999999753


No 22 
>PF10579 Rapsyn_N:  Rapsyn N-terminal myristoylation and linker region;  InterPro: IPR019568  Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane. Rapsyn is a peripheral membrane protein that is selectively concentrated at the neuromuscular junction and is essential for the formation of synaptic acetylcholine receptor aggregates. Acetylcholine receptors fail to aggregate beneath nerve terminals in mice where rapsyn has been knocked out. The N-terminal six amino acids of rapsyn are its myristoylation site, and myristoylation is necessary for the targeting of the protein to the membrane []. ; GO: 0008270 zinc ion binding, 0033130 acetylcholine receptor binding, 0007268 synaptic transmission, 0005856 cytoskeleton, 0030054 cell junction, 0045211 postsynaptic membrane
Probab=49.23  E-value=13  Score=22.04  Aligned_cols=20  Identities=25%  Similarity=0.586  Sum_probs=16.3

Q ss_pred             CHHHHHHHHHHHHHhhcccc
Q 047650           51 NIKKVQNWRQALKVVANISG   70 (75)
Q Consensus        51 ~~e~v~~W~~AL~~va~~~G   70 (75)
                      +.+-+.+|+.||..+.+-++
T Consensus        22 ~~~Al~~W~~aL~k~~~~~~   41 (80)
T PF10579_consen   22 TQQALQKWRKALEKITDRED   41 (80)
T ss_pred             HHHHHHHHHHHHhhcCChHH
Confidence            35679999999999988654


No 23 
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain. Set binding factor Pleckstrin Homology (PH) domain. Set binding factor is a  myotubularin-related pseudo-phosphatase consisting of a Denn domain,  a Gram domain, an inactive phosphatase domain, a SID motif and a C-terminal PH domain. Its PH domain is predicted to bind lipids based upon its ability to respond to phosphatidylinositol 3-kinase .
Probab=48.71  E-value=20  Score=20.49  Aligned_cols=16  Identities=25%  Similarity=0.763  Sum_probs=13.7

Q ss_pred             cCHHHHHHHHHHHHHh
Q 047650           50 DNIKKVQNWRQALKVV   65 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~v   65 (75)
                      ++++..+.|..||..+
T Consensus        85 ~s~~e~~~Wi~ai~~~  100 (101)
T cd01235          85 ENINEAQRWKEKIQQC  100 (101)
T ss_pred             CCHHHHHHHHHHHHhh
Confidence            5678899999999875


No 24 
>PRK05225 ketol-acid reductoisomerase; Validated
Probab=46.09  E-value=9  Score=29.58  Aligned_cols=58  Identities=17%  Similarity=0.101  Sum_probs=37.1

Q ss_pred             ChHHHHHHHhh-hcCCCe------------------------eeeeeeecccCcceeccchHHHHHHHhHHhhccCHHHH
Q 047650            1 CLDELLKIVEC-KNRKNQ------------------------NFPTFNDVEPTIVRKQTTTFGEAFAKHEEFFKDNIKKV   55 (75)
Q Consensus         1 CLdEL~~I~e~-~~~~~~------------------------ViPVFY~V~ps~Vr~q~g~f~~~f~~~~~~~~~~~e~v   55 (75)
                      |++++..|.|. ..+|..                        .-|||=++-- +  -|+|.|.+.+-.-.+.   +..+.
T Consensus       253 ~~~~~E~I~e~i~e~GI~~m~d~~S~tak~ga~~~~~~~k~~m~p~f~~~~~-~--I~sG~fak~~m~d~~~---~~~~l  326 (487)
T PRK05225        253 IQFGWETITEALKQGGITLMMDRLSNPAKIRAFELSEQLKEIMAPLFQKHMD-D--IISGEFSSTMMADWAN---DDKKL  326 (487)
T ss_pred             HhhhHHHHHHHHHhccHHHHHHhccchhhcccccccHHHHHHHHHHHHHHHH-H--hhccHHHHHHHHHHhc---CChHH
Confidence            55677777777 666654                        4577743221 1  2588888877654433   35679


Q ss_pred             HHHHHHHHH
Q 047650           56 QNWRQALKV   64 (75)
Q Consensus        56 ~~W~~AL~~   64 (75)
                      .+||.+++.
T Consensus       327 ~~~r~~~~~  335 (487)
T PRK05225        327 LTWREETGK  335 (487)
T ss_pred             HHHHHHhhc
Confidence            999998764


No 25 
>COG1904 UxaC Glucuronate isomerase [Carbohydrate transport and metabolism]
Probab=45.69  E-value=26  Score=26.96  Aligned_cols=67  Identities=10%  Similarity=0.090  Sum_probs=43.9

Q ss_pred             HHHHHHHhh-hcCCCeeeeeeeecccCcceec---cc------hHHHHHHHhHHhhccCHHHHHHHHHHHHHhhccc
Q 047650            3 DELLKIVEC-KNRKNQNFPTFNDVEPTIVRKQ---TT------TFGEAFAKHEEFFKDNIKKVQNWRQALKVVANIS   69 (75)
Q Consensus         3 dEL~~I~e~-~~~~~~ViPVFY~V~ps~Vr~q---~g------~f~~~f~~~~~~~~~~~e~v~~W~~AL~~va~~~   69 (75)
                      +.|-+.+++ ...+....-|||-.+|++-+..   .|      .||+.-.-..--|.+..+-+++-+..|++++-++
T Consensus       324 ~~L~~LLd~~~~~~~L~k~ily~lnp~~~~~latm~g~fq~~~~~~~~q~G~~WWFnD~~dGM~r~~e~la~~gl~~  400 (463)
T COG1904         324 EGLKPLLDAFGEDNDLPKTILYLLNPNDNEVLATMAGNFQGEGVSPKLQFGPAWWFNDSKDGMERQREQLASLGLLS  400 (463)
T ss_pred             HHHHHHHHhhcccCCCceEEEEecCCchhHHHHHHHhhccccccCcccccCcchhhcCChHHHHHHHHHHHHHHHHH
Confidence            467888888 7777776689999999985432   23      3332211111223345677999999999887655


No 26 
>PRK10072 putative transcriptional regulator; Provisional
Probab=43.97  E-value=20  Score=21.56  Aligned_cols=59  Identities=15%  Similarity=0.177  Sum_probs=30.8

Q ss_pred             hHHHHHHHhh--hcCCCeeeeee-eecccCcceeccchHHHHHHHhHHhhccCHHHHHHHHH
Q 047650            2 LDELLKIVEC--KNRKNQNFPTF-NDVEPTIVRKQTTTFGEAFAKHEEFFKDNIKKVQNWRQ   60 (75)
Q Consensus         2 LdEL~~I~e~--~~~~~~ViPVF-Y~V~ps~Vr~q~g~f~~~f~~~~~~~~~~~e~v~~W~~   60 (75)
                      +++|.+=++.  ...|..-+-+| |.++|.+++.....-|-.-.+..+..+-+...|.+|..
T Consensus         7 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~eik~LR~~~glTQ~elA~~lGvS~~TVs~WE~   68 (96)
T PRK10072          7 MFELLSSLEQIVFKDETQKITLTQKTTSFTEFEQLRKGTGLKIDDFARVLGVSVAMVKEWES   68 (96)
T ss_pred             HHHHHHHHHHHHHhcCCccceeecccCChHHHHHHHHHcCCCHHHHHHHhCCCHHHHHHHHc
Confidence            4555555554  44444333344 67788888765433332222233333445678888864


No 27 
>cd00821 PH Pleckstrin homology (PH) domain. Pleckstrin homology (PH) domain. PH domains are only found in eukaryotes. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=42.85  E-value=25  Score=18.50  Aligned_cols=16  Identities=19%  Similarity=0.509  Sum_probs=12.9

Q ss_pred             cCHHHHHHHHHHHHHh
Q 047650           50 DNIKKVQNWRQALKVV   65 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~v   65 (75)
                      .+.+...+|.+||..+
T Consensus        81 ~s~~~~~~W~~~l~~~   96 (96)
T cd00821          81 ESEEEREEWIEALQSA   96 (96)
T ss_pred             CCHHHHHHHHHHHhcC
Confidence            4678899999999753


No 28 
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain. Centaurin Pleckstrin homology (PH) domain. Centaurin beta and gamma consist of a PH domain, an ArfGAP domain and three ankyrin repeats. Centaurain gamma also has an N-terminal Ras homology domain. Centaurin alpha has a different domain architecture and its PH domain is in a different subfamily.  Centaurin can bind to phosphatidlyinositol (3,4,5)P3.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=42.53  E-value=24  Score=19.55  Aligned_cols=15  Identities=20%  Similarity=0.516  Sum_probs=12.6

Q ss_pred             cCHHHHHHHHHHHHH
Q 047650           50 DNIKKVQNWRQALKV   64 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~   64 (75)
                      ++.+..++|..||..
T Consensus        79 ~s~~~~~~Wi~al~~   93 (94)
T cd01250          79 DSEEERDDWISAIQE   93 (94)
T ss_pred             CCHHHHHHHHHHHhc
Confidence            467899999999964


No 29 
>cd00900 PH-like Pleckstrin homology-like domain. Pleckstrin homology-like domain.  This family includes the PH domain, both the Shc-like and IRS-like PTB domains, the ran-binding domain, the EVH1 domain, a domain in neurobeachin and the third domain of FERM. All of these domains have a PH fold, but lack significant sequence similarity. They are generally involved in targeting to protein to the appropriate cellular location or interacting with a binding partner.  The PH domain is commonly found in eukaryotic signaling proteins. This domain family possesses multiple functions including the ability to bind inositol phosphates and to other proteins.
Probab=42.24  E-value=26  Score=18.63  Aligned_cols=16  Identities=31%  Similarity=0.613  Sum_probs=12.8

Q ss_pred             cCHHHHHHHHHHHHHh
Q 047650           50 DNIKKVQNWRQALKVV   65 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~v   65 (75)
                      .+.+..+.|..||.++
T Consensus        84 ~~~~~~~~W~~al~~~   99 (99)
T cd00900          84 DSEEEAQEWVEALQQA   99 (99)
T ss_pred             CCHHHHHHHHHHHhcC
Confidence            3567899999999764


No 30 
>PF15409 PH_8:  Pleckstrin homology domain
Probab=42.08  E-value=28  Score=20.77  Aligned_cols=15  Identities=27%  Similarity=0.501  Sum_probs=13.0

Q ss_pred             CHHHHHHHHHHHHHh
Q 047650           51 NIKKVQNWRQALKVV   65 (75)
Q Consensus        51 ~~e~v~~W~~AL~~v   65 (75)
                      +.+..+.|..||..+
T Consensus        74 s~~~f~~Wv~aL~~a   88 (89)
T PF15409_consen   74 SQEDFQRWVSALQKA   88 (89)
T ss_pred             CHHHHHHHHHHHHhc
Confidence            678899999999875


No 31 
>PF03429 MSP1b:  Major surface protein 1B;  InterPro: IPR005091  The major surface protein (MSP1) of the cattle pathogen Anaplasma is a heterodimer comprised of MSP1a and MSP1b. This family is the MSP1b chain. The MSP1 proteins are putative adhesins for bovine erythrocytes.
Probab=41.99  E-value=26  Score=27.48  Aligned_cols=46  Identities=15%  Similarity=0.302  Sum_probs=33.8

Q ss_pred             eeeeeeecccCcceeccchH-HHHHHHhHHhhccCHHHHHHHHHHHHHhhcc
Q 047650           18 NFPTFNDVEPTIVRKQTTTF-GEAFAKHEEFFKDNIKKVQNWRQALKVVANI   68 (75)
Q Consensus        18 ViPVFY~V~ps~Vr~q~g~f-~~~f~~~~~~~~~~~e~v~~W~~AL~~va~~   68 (75)
                      ..-+-|+|+  .+.+..|.| |+.+.+..++.   .+--++|-.||.+|-++
T Consensus       207 LveasyGvs--yane~MGK~AGKGLEKCknKL---~~A~~KW~~A~~EieaL  253 (726)
T PF03429_consen  207 LVEASYGVS--YANETMGKYAGKGLEKCKNKL---EAACQKWHDALQEIEAL  253 (726)
T ss_pred             hHHhhhhhh--hhhchhhhhhcccHHHHHHHH---HHHHHHHHHHHHHHHHH
Confidence            444556665  455567877 68888887776   46789999999998765


No 32 
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain. RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain. This protein consists of two C2 domains, followed by a RasGAP domain, a PH domain and a BTK domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPAses, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=40.43  E-value=27  Score=20.88  Aligned_cols=16  Identities=19%  Similarity=0.391  Sum_probs=13.4

Q ss_pred             cCHHHHHHHHHHHHHh
Q 047650           50 DNIKKVQNWRQALKVV   65 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~v   65 (75)
                      ++.+....|..||.+|
T Consensus        83 ~s~~E~~~Wi~al~k~   98 (98)
T cd01244          83 EAPVEATDWLNALEKQ   98 (98)
T ss_pred             CCHHHHHHHHHHHhcC
Confidence            4678899999999875


No 33 
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain. Cytohesin Pleckstrin homology (PH) domain. Cytohesin is an ARF-Guanine nucleotide Exchange Factor (GEF), which has a Sec7-type Arf-GEFdomain and a pleckstrin homology domain. It specifically binds phosphatidylinositol-3,4,5-trisphosphate (PtdIns(3,4, 5)P3) via its PH domain and it acts as a PI 3-kinase effector mediating biological responses such as cell adhesion and membrane trafficking.  PH domains are only found in eukaryotes. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=40.32  E-value=32  Score=20.87  Aligned_cols=18  Identities=17%  Similarity=0.466  Sum_probs=15.1

Q ss_pred             cCHHHHHHHHHHHHHhhc
Q 047650           50 DNIKKVQNWRQALKVVAN   67 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~va~   67 (75)
                      ++.+..+.|..||..+..
T Consensus        97 ~s~~e~~~Wi~al~~~~~  114 (125)
T cd01252          97 ANDEEMDEWIKSIKASIS  114 (125)
T ss_pred             CCHHHHHHHHHHHHHHHh
Confidence            568899999999988763


No 34 
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 Pleckstrin Homology (PH) domain. EFA6  is an guanine nucleotide exchange factor for ARF6, which is involved in membrane recycling. It consists of a SEC7 domain followed by a PH domain.  The EFA6 PH domain regulates its association with the plasma membrane. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=40.08  E-value=31  Score=21.39  Aligned_cols=19  Identities=32%  Similarity=0.677  Sum_probs=16.3

Q ss_pred             cCHHHHHHHHHHHHHhhcc
Q 047650           50 DNIKKVQNWRQALKVVANI   68 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~va~~   68 (75)
                      .+.+.+++|-.||..+|..
T Consensus        95 ~~~ee~~~Wi~~I~~~~~~  113 (117)
T cd01230          95 SSLKELQSWIERINVVAAA  113 (117)
T ss_pred             CCHHHHHHHHHHHHHHHHh
Confidence            3678999999999999864


No 35 
>PF09838 DUF2065:  Uncharacterized protein conserved in bacteria (DUF2065);  InterPro: IPR019201  This entry represents a protein found in various prokaryotic proteins, and has no known function. 
Probab=39.47  E-value=26  Score=19.19  Aligned_cols=17  Identities=24%  Similarity=0.691  Sum_probs=13.5

Q ss_pred             HHHHHHHHHhhcccccc
Q 047650           56 QNWRQALKVVANISGWE   72 (75)
Q Consensus        56 ~~W~~AL~~va~~~G~~   72 (75)
                      ++||+++.++++++.-.
T Consensus        21 ~~~r~~l~~l~~~p~~~   37 (57)
T PF09838_consen   21 ERWRRMLRQLAQLPDRQ   37 (57)
T ss_pred             HHHHHHHHHHHhCCHHH
Confidence            57999999999887543


No 36 
>PF01320 Colicin_Pyocin:  Colicin immunity protein / pyocin immunity protein;  InterPro: IPR023802 Bacterial colicin and pyocin immunity proteins [, ] can bind specifically to the DNase-type colicins and pyocins and inhibit their bactericidal activity. The 1.8-angstrom crystal structure of the ImmE7 protein consists of four antiparallel alpha-helices []. Sequence similarities between colicins E2, A and E1 [] are less striking. The colicin E2 (pyocin) immunity protein does not share similarity with either the colicin E3 or cloacin DF13 [] immunity proteins. Pyocin protects a cell that harbours the plasmid ColE2 encoding colicin E2 against colicin E2; it is thus essential both for autonomous replication and colicin E2 immunity []. This entry represents the structural domain of colicin and pyocin immunity proteins.; GO: 0015643 toxin binding, 0030153 bacteriocin immunity; PDB: 1GXH_A 1GXG_A 1MZ8_C 2ERH_A 1ZNV_C 1AYI_A 1UNK_A 2JBG_A 7CEI_A 1CEI_A ....
Probab=38.45  E-value=26  Score=20.83  Aligned_cols=15  Identities=33%  Similarity=0.858  Sum_probs=9.5

Q ss_pred             HHHHHHHHHHHHhhccccc
Q 047650           53 KKVQNWRQALKVVANISGW   71 (75)
Q Consensus        53 e~v~~W~~AL~~va~~~G~   71 (75)
                      +.|.+||+|    -.++||
T Consensus        69 ~~vKeWRa~----nG~pgF   83 (85)
T PF01320_consen   69 KEVKEWRAS----NGKPGF   83 (85)
T ss_dssp             HHHHHHHHH----TT---S
T ss_pred             HHHHHHHHH----cCCCcc
Confidence            568999998    666665


No 37 
>PHA03068 DNA-binding phosphoprotein; Provisional
Probab=36.87  E-value=31  Score=24.69  Aligned_cols=23  Identities=22%  Similarity=0.234  Sum_probs=15.8

Q ss_pred             hHHHHHHHhh--hcCCCeeee-eeee
Q 047650            2 LDELLKIVEC--KNRKNQNFP-TFND   24 (75)
Q Consensus         2 LdEL~~I~e~--~~~~~~ViP-VFY~   24 (75)
                      ++||......  +.-+.++.| |||.
T Consensus       175 ~~ElE~LskRD~QMak~il~PivfYr  200 (270)
T PHA03068        175 SEELESLSKRDPQMAKAILVPIVFYR  200 (270)
T ss_pred             HHHHHhhhhhcHhhhheeeeeEEEEe
Confidence            4677776666  344568889 7886


No 38 
>COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only]
Probab=36.78  E-value=50  Score=22.21  Aligned_cols=38  Identities=18%  Similarity=0.239  Sum_probs=25.5

Q ss_pred             hHHHHHHHhh-h-cCCCeeeeeeeecccCcce-eccchHHH
Q 047650            2 LDELLKIVEC-K-NRKNQNFPTFNDVEPTIVR-KQTTTFGE   39 (75)
Q Consensus         2 LdEL~~I~e~-~-~~~~~ViPVFY~V~ps~Vr-~q~g~f~~   39 (75)
                      |.+|..+++. . ..+..|-+||--|||..=- .+-..|+.
T Consensus        87 l~~l~~~~~~l~~~~~~~v~vv~itvDPerDtp~~lk~Y~~  127 (207)
T COG1999          87 LAELKALLKKLGEGEGDDVQVVFITVDPERDTPEVLKKYAE  127 (207)
T ss_pred             HHHHHHHHHHhccccCCCEEEEEEEECCCCCCHHHHHHHhc
Confidence            4566677776 4 6678899999999997432 22344544


No 39 
>PHA00407 phage lambda Rz1-like protein
Probab=36.65  E-value=25  Score=20.80  Aligned_cols=23  Identities=39%  Similarity=0.613  Sum_probs=16.7

Q ss_pred             CHHHHHHHHHHHH-----Hhhccccccc
Q 047650           51 NIKKVQNWRQALK-----VVANISGWEL   73 (75)
Q Consensus        51 ~~e~v~~W~~AL~-----~va~~~G~~~   73 (75)
                      ...+..+||.||.     -|+.++|..+
T Consensus        24 tkktl~rwkaaLIGlllicv~tISGCaS   51 (84)
T PHA00407         24 TKKTLRRWKAALIGLLLICVATISGCAS   51 (84)
T ss_pred             hhhhhHHHHHHHHHHHHHHHHHHhhhhh
Confidence            3567999999974     5677777543


No 40 
>PF15410 PH_9:  Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A.
Probab=35.54  E-value=44  Score=20.33  Aligned_cols=17  Identities=18%  Similarity=0.505  Sum_probs=14.2

Q ss_pred             cCHHHHHHHHHHHHHhh
Q 047650           50 DNIKKVQNWRQALKVVA   66 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~va   66 (75)
                      .+.+.+..|..+++.+|
T Consensus       102 ~~~~~m~~Wi~~IN~~A  118 (119)
T PF15410_consen  102 SDEEEMNEWIDAINYAA  118 (119)
T ss_dssp             SSHHHHHHHHHHHHHH-
T ss_pred             CCHHHHHHHHHHHhhhc
Confidence            47899999999999886


No 41 
>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only]
Probab=33.78  E-value=38  Score=26.88  Aligned_cols=20  Identities=30%  Similarity=0.522  Sum_probs=17.0

Q ss_pred             HHHHHHHhh--hcCCCeeeeee
Q 047650            3 DELLKIVEC--KNRKNQNFPTF   22 (75)
Q Consensus         3 dEL~~I~e~--~~~~~~ViPVF   22 (75)
                      .||++++..  +.+|.+.||+|
T Consensus       395 ~~L~~vi~~t~~rGGKvLIP~f  416 (637)
T COG1782         395 KELIKVINDTLKRGGKVLIPVF  416 (637)
T ss_pred             HHHHHHHHHHHhcCCeEEEEee
Confidence            478888887  88899999999


No 42 
>cd01040 globin Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.
Probab=33.46  E-value=1e+02  Score=18.04  Aligned_cols=33  Identities=24%  Similarity=0.308  Sum_probs=21.6

Q ss_pred             hHHHHHHHhHHhh-c--cCHHHHHHHHHHHHHhhcc
Q 047650           36 TFGEAFAKHEEFF-K--DNIKKVQNWRQALKVVANI   68 (75)
Q Consensus        36 ~f~~~f~~~~~~~-~--~~~e~v~~W~~AL~~va~~   68 (75)
                      .|+++|...-... +  .+.+..+.|..++..+++.
T Consensus       104 ~~~~~l~~~l~~~~~~~~~~~~~~aW~~~~~~i~~~  139 (140)
T cd01040         104 LFGEALLEVLAEVLGDDFTPEVKAAWDKLLDVIADA  139 (140)
T ss_pred             HHHHHHHHHHHHHhCCcCCHHHHHHHHHHHHHHHHh
Confidence            4555555543322 2  2678899999999988763


No 43 
>PRK05422 smpB SsrA-binding protein; Validated
Probab=33.24  E-value=44  Score=21.90  Aligned_cols=33  Identities=9%  Similarity=0.027  Sum_probs=24.3

Q ss_pred             HHHHHHHhh-hcCCCeeeeeeeecccCcceeccc
Q 047650            3 DELLKIVEC-KNRKNQNFPTFNDVEPTIVRKQTT   35 (75)
Q Consensus         3 dEL~~I~e~-~~~~~~ViPVFY~V~ps~Vr~q~g   35 (75)
                      .|+.+|... +..|.+++|+--...-+-|+-..|
T Consensus        86 ~EI~kl~~~~~~kG~TiVPl~ly~k~g~iKveIa  119 (148)
T PRK05422         86 KEIDKLIGKVERKGYTLVPLKLYFKNGRAKVEIG  119 (148)
T ss_pred             HHHHHHHHHHhcCCcEEEeehhhCcCCEEEEEEE
Confidence            588899998 899999999543336666766544


No 44 
>PF13676 TIR_2:  TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_A 3UB2_A.
Probab=32.96  E-value=34  Score=19.46  Aligned_cols=25  Identities=24%  Similarity=0.307  Sum_probs=15.2

Q ss_pred             ChHHHHHHHhhhcCCCeeeeeeeecccCcc
Q 047650            1 CLDELLKIVECKNRKNQNFPTFNDVEPTIV   30 (75)
Q Consensus         1 CLdEL~~I~e~~~~~~~ViPVFY~V~ps~V   30 (75)
                      |..|+....+   .+..|+||.  +++.++
T Consensus        67 ~~~E~~~a~~---~~~~iipv~--~~~~~~   91 (102)
T PF13676_consen   67 CRFELGAAWK---RGKPIIPVR--LDPCEL   91 (102)
T ss_dssp             HHHHHHHHHC---TSESEEEEE--CSGGGS
T ss_pred             HHHHHHHHHH---CCCEEEEEE--ECCcCC
Confidence            5566555533   456899998  444443


No 45 
>PRK02797 4-alpha-L-fucosyltransferase; Provisional
Probab=31.98  E-value=1.2e+02  Score=22.37  Aligned_cols=17  Identities=35%  Similarity=0.657  Sum_probs=13.5

Q ss_pred             CHHHHHHHHHHHHHhhc
Q 047650           51 NIKKVQNWRQALKVVAN   67 (75)
Q Consensus        51 ~~e~v~~W~~AL~~va~   67 (75)
                      ++.-++.|++||..++.
T Consensus       303 ~pn~~~~W~~~l~~~~g  319 (322)
T PRK02797        303 SPNYLQGWRNALAIAAG  319 (322)
T ss_pred             CHhHHHHHHHHHHHhhC
Confidence            35668999999988764


No 46 
>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain. Anillin Pleckstrin homology (PH) domain.  Anillin is an actin binding protein involved in cytokinesis. It has a C-terminal PH domain, which has been shown to be necessary, but not sufficient for targetting of anillin to ectopic septin containing foci . PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPAses, adaptors, a well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=31.71  E-value=42  Score=20.99  Aligned_cols=16  Identities=25%  Similarity=0.449  Sum_probs=13.4

Q ss_pred             cCHHHHHHHHHHHHHh
Q 047650           50 DNIKKVQNWRQALKVV   65 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~v   65 (75)
                      ++.+..+.|..||+++
T Consensus       107 Dt~eer~~W~~ain~~  122 (122)
T cd01263         107 DTKEERQTWLSLLNST  122 (122)
T ss_pred             CCHHHHHHHHHHHhcC
Confidence            4678999999999864


No 47 
>TIGR00086 smpB SsrA-binding protein. This model describes the SsrA-binding protein, also called tmRNA binding protein, small protein B, and SmpB. The small, stable RNA SsrA (also called tmRNA or 10Sa RNA) recognizes stalled ribosomes such as occur during translation from message that lacks a stop codon. It becomes charged with Ala like a tRNA, then acts as mRNA to resume translation started with the defective mRNA. The short C-terminal peptide tag added by the SsrA system marks the abortively translated protein for degradation. SmpB binds SsrA after its aminoacylation but before the coupling of the Ala to the nascent polypeptide chain and is an essential part of the SsrA peptide tagging system. SmpB has been associated with the survival of bacterial pathogens in conditions of stress. It is universal in the first 100 sequenced bacterial genomes.
Probab=31.08  E-value=49  Score=21.57  Aligned_cols=33  Identities=15%  Similarity=0.047  Sum_probs=22.9

Q ss_pred             HHHHHHHhh-hcCCCeeeeeeeecc-cCcceeccc
Q 047650            3 DELLKIVEC-KNRKNQNFPTFNDVE-PTIVRKQTT   35 (75)
Q Consensus         3 dEL~~I~e~-~~~~~~ViPVFY~V~-ps~Vr~q~g   35 (75)
                      .|+.++... +..|.+++|.=-..+ -+-++-+.|
T Consensus        82 ~EI~kL~~~~~~kG~TiVPl~ly~~~~g~~KveIa  116 (144)
T TIGR00086        82 KEIDKLQGKVKEKGLTLVPLKLYFKNKGKVKVEIA  116 (144)
T ss_pred             HHHHHHHHHHhcCCeEEEeeEEEEecCCEEEEEEE
Confidence            488899988 889999999432224 355665543


No 48 
>COG1155 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion]
Probab=30.92  E-value=56  Score=25.87  Aligned_cols=34  Identities=12%  Similarity=0.141  Sum_probs=24.1

Q ss_pred             HHHHHHHhHHhhccCHHHHHHHHHHHHHhhcccc
Q 047650           37 FGEAFAKHEEFFKDNIKKVQNWRQALKVVANISG   70 (75)
Q Consensus        37 f~~~f~~~~~~~~~~~e~v~~W~~AL~~va~~~G   70 (75)
                      +++-|.+..-...-..|--.+|..||.+++...+
T Consensus       312 iaEY~RDmGy~v~lmADSTSRWAEAlREisgRle  345 (588)
T COG1155         312 IAEYYRDMGYDVALMADSTSRWAEALREISGRLE  345 (588)
T ss_pred             HHHHHHhhhhhhHHhhchHHHHHHHHHHHhcccc
Confidence            4566666554433345778999999999998765


No 49 
>PF15043 CNRIP1:  CB1 cannabinoid receptor-interacting protein 1
Probab=30.73  E-value=23  Score=23.52  Aligned_cols=7  Identities=43%  Similarity=0.862  Sum_probs=6.5

Q ss_pred             eeeeecc
Q 047650           20 PTFNDVE   26 (75)
Q Consensus        20 PVFY~V~   26 (75)
                      ||||+||
T Consensus        22 PVffKvD   28 (161)
T PF15043_consen   22 PVFFKVD   28 (161)
T ss_pred             cEEEEec
Confidence            8999998


No 50 
>KOG4116 consensus Ubiquinol cytochrome c reductase, subunit QCR8 [Energy production and conversion]
Probab=30.45  E-value=56  Score=19.72  Aligned_cols=29  Identities=21%  Similarity=0.214  Sum_probs=25.0

Q ss_pred             eeeecccCcceeccchHHHHHHHhHHhhc
Q 047650           21 TFNDVEPTIVRKQTTTFGEAFAKHEEFFK   49 (75)
Q Consensus        21 VFY~V~ps~Vr~q~g~f~~~f~~~~~~~~   49 (75)
                      |=|.++|-+=|-..|.|.++|...-.++.
T Consensus        22 isYaLSPfeQra~~g~F~~~~~n~fRr~~   50 (90)
T KOG4116|consen   22 ISYALSPFEQRAYAGFFDKAFPNMFRRFR   50 (90)
T ss_pred             EEEecCchhhccccchhhhhhHHHHHHhh
Confidence            56999999999999999999988777765


No 51 
>cd00153 RalGDS_RA Ubiquitin domain of  RalGDS-like factor (RLF) and related proteins. This CD represents the C-terminal Ras-associating (RA) domain of three closely related guanine-nucleotide exchange factors (GEF's),  Ral guanine nucleotide dissociation stimulator (RalGDS), RalGDS-like (RGL), and RalGDS-like factor (RLF).  The RalGDS proteins are downstream effectors of the Ras-related protein Ral, providing a mechanism for Ral activation by extracellular signals.  The RA domain is structurally similar to ubiquitin and exists in a number of other signalling proteins including AF6, rasfadin, SNX27, CYR1, and STE50.
Probab=30.15  E-value=37  Score=20.39  Aligned_cols=15  Identities=20%  Similarity=0.536  Sum_probs=12.2

Q ss_pred             CCCeeee----eeeecccC
Q 047650           14 RKNQNFP----TFNDVEPT   28 (75)
Q Consensus        14 ~~~~ViP----VFY~V~ps   28 (75)
                      .+-.+||    |||.+.|+
T Consensus        59 d~El~iP~~aNvfYAm~~~   77 (87)
T cd00153          59 DRELVIPDNANVFYAMNPA   77 (87)
T ss_pred             CceEeccCCCceEEEecCC
Confidence            4567888    99999986


No 52 
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion]
Probab=29.88  E-value=28  Score=25.90  Aligned_cols=27  Identities=15%  Similarity=0.091  Sum_probs=22.1

Q ss_pred             hcCCCeeeeeeeecccCcceec--cchHHHH
Q 047650           12 KNRKNQNFPTFNDVEPTIVRKQ--TTTFGEA   40 (75)
Q Consensus        12 ~~~~~~ViPVFY~V~ps~Vr~q--~g~f~~~   40 (75)
                      ++++|+|||  |.=|++++|+.  .|..|.-
T Consensus        83 k~GSQviiP--yR~d~~~~r~lkvmGdLGQv  111 (391)
T KOG2865|consen   83 KMGSQVIIP--YRGDEYDPRHLKVMGDLGQV  111 (391)
T ss_pred             hcCCeEEEe--ccCCccchhheeecccccce
Confidence            678899999  89999999987  5777643


No 53 
>PF04661 Pox_I3:  Poxvirus I3 ssDNA-binding protein;  InterPro: IPR006754  The 34kDa protein encoded by the I3 gene of vaccinia virus is expressed at early and intermediate times post-infection and is phosphorylated on serine residues. I3 protein demonstrates a striking affinity for single-stranded, but not for double-stranded, DNA which suggests a role in DNA replication and/or repair. Electrophoretic mobility shift assays indicate that numerous I3 molecules can bind to a template, reflecting the stoichiometric interaction of I3 with DNA. Sequence analysis reveals that a pattern of aromatic and charged amino acids common to many replicative single-stranded DNA binding proteins (SSBs) is conserved in I3 [].; GO: 0003697 single-stranded DNA binding
Probab=29.39  E-value=44  Score=23.89  Aligned_cols=23  Identities=22%  Similarity=0.153  Sum_probs=16.0

Q ss_pred             hHHHHHHHhh--hcCCCeeee-eeee
Q 047650            2 LDELLKIVEC--KNRKNQNFP-TFND   24 (75)
Q Consensus         2 LdEL~~I~e~--~~~~~~ViP-VFY~   24 (75)
                      .+||......  +.-..++.| |||.
T Consensus       165 ~~ElE~LakRd~Qmak~il~PivfYr  190 (262)
T PF04661_consen  165 DRELENLAKRDKQMAKIILVPIVFYR  190 (262)
T ss_pred             HHHHHhhhhhhhhHHhheeeeEEEEe
Confidence            3567776666  345778999 7886


No 54 
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain. Unc-104 pleckstrin homology (PH) domain. Unc-104 is a kinesin-like protein containing an N-terminal kinesin catalytic domain, followed by a forkhead associated domain with a C-terminal PH domain. These proteins are responsible for the transport of membrane vesicles along microtubules. The mechanism involves the binding of the  PH domain to phosphatidiylinositol (4,5) P2-containing liposomes.
Probab=28.69  E-value=61  Score=18.91  Aligned_cols=16  Identities=25%  Similarity=0.353  Sum_probs=13.1

Q ss_pred             cCHHHHHHHHHHHHHh
Q 047650           50 DNIKKVQNWRQALKVV   65 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~v   65 (75)
                      .+.+.++.|..||...
T Consensus        82 ~s~~e~~~Wi~ai~~~   97 (100)
T cd01233          82 LSDKEMIDWLYALNPL   97 (100)
T ss_pred             CCHHHHHHHHHHhhhh
Confidence            4678999999999753


No 55 
>PF12006 DUF3500:  Protein of unknown function (DUF3500);  InterPro: IPR021889  This family of proteins is functionally uncharacterised. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 335 to 438 amino acids in length. This protein has a conserved GHH sequence motif. This protein has two completely conserved G residues that may be functionally important. 
Probab=28.34  E-value=36  Score=24.53  Aligned_cols=20  Identities=30%  Similarity=0.300  Sum_probs=17.4

Q ss_pred             CeeeeeeeecccCcceeccc
Q 047650           16 NQNFPTFNDVEPTIVRKQTT   35 (75)
Q Consensus        16 ~~ViPVFY~V~ps~Vr~q~g   35 (75)
                      ..+-|+||+.+|..+....|
T Consensus       143 v~~tP~F~Ga~P~~~~~~~G  162 (313)
T PF12006_consen  143 VSITPTFFGAEPAEVDEYKG  162 (313)
T ss_pred             EEECceeeCCCCCcccccCC
Confidence            46789999999999998777


No 56 
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain. PARIS-1 pleckstrin homology (PH) domain. PARIS-1 contains a  PH domain and a TBC-type GTPase catalytic domain.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=27.80  E-value=69  Score=18.57  Aligned_cols=16  Identities=31%  Similarity=0.482  Sum_probs=13.3

Q ss_pred             cCHHHHHHHHHHHHHh
Q 047650           50 DNIKKVQNWRQALKVV   65 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~v   65 (75)
                      ++++..++|..||...
T Consensus        78 ~s~~e~~~Wi~al~~~   93 (95)
T cd01265          78 SSDKQMNYWLQALQSK   93 (95)
T ss_pred             CCHHHHHHHHHHHHhh
Confidence            4678899999999764


No 57 
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain. Insulin receptor substrate (IRS) pleckstrin homology (PH) domain. PH domains are only found in eukaryotes, and are often involved in targeting proteins to the plasma membrane via lipid binding. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPases, adaptors, a well as cytoskeletal associated molecules and in lipid associated enzymes.  The IRS PH domain targets IRS molecules to the plasma membrane, usually in response to insulin stimulation.
Probab=27.75  E-value=63  Score=19.39  Aligned_cols=16  Identities=31%  Similarity=0.505  Sum_probs=13.3

Q ss_pred             cCHHHHHHHHHHHHHh
Q 047650           50 DNIKKVQNWRQALKVV   65 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~v   65 (75)
                      ++++..+.|-.||.++
T Consensus        86 ese~E~~~Wi~~i~~~  101 (101)
T cd01257          86 ENEAEQDSWYQALLEL  101 (101)
T ss_pred             CCHHHHHHHHHHHhhC
Confidence            5678899999999764


No 58 
>PF10657 RC-P840_PscD:  Photosystem P840 reaction centre protein PscD;  InterPro: IPR019608 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product.  The photosynthetic reaction centres (RCs) of aerotolerant organisms contain a heterodimeric core, built up of two strongly homologous polypeptides each of which contributes five transmembrane peptide helices to hold a pseudo-symmetric double set of redox components. Two molecules of PscD are housed within a subunit. PscD may be involved in stabilising the PscB component since it is found to co-precipitate with FMO (Fenna-Mathews-Olson BChl a-protein) and PscB. It may also be involved in the interaction with ferredoxin []. 
Probab=26.94  E-value=27  Score=22.55  Aligned_cols=9  Identities=22%  Similarity=0.708  Sum_probs=7.1

Q ss_pred             eeeeeeeec
Q 047650           17 QNFPTFNDV   25 (75)
Q Consensus        17 ~ViPVFY~V   25 (75)
                      .=|||||+-
T Consensus       115 RdipVfy~~  123 (144)
T PF10657_consen  115 RDIPVFYNS  123 (144)
T ss_pred             ecCceEEcc
Confidence            458999974


No 59 
>PF02630 SCO1-SenC:  SCO1/SenC;  InterPro: IPR003782 This family is involved in biogenesis of respiratory and photosynthetic systems. In yeast the SCO1 protein is specifically required for a post-translational step in the accumulation of subunits 1 and 2 of cytochrome c oxidase (COXI and COX-II) []. It is a mitochondrion-associated cytochrome c oxidase assembly factor. The purple nonsulphur photosynthetic eubacterium Rhodobacter capsulatus is a versatile organism that can obtain cellular energy by several means, including the capture of light energy for photosynthesis as well as the use of light-independent respiration, in which molecular oxygen serves as a terminal electron acceptor. The SenC protein is required for optimal cytochrome c oxidase activity in aerobically grown R. capsulatus cells and is involved in the induction of structural polypeptides of the light-harvesting and reaction centre complexes [].; PDB: 2K6V_A 3ME8_A 3ME7_A 2GT6_A 2GQL_A 2GQK_A 2GGT_B 1WP0_C 2HRN_A 2GQM_A ....
Probab=26.82  E-value=66  Score=20.73  Aligned_cols=40  Identities=15%  Similarity=0.218  Sum_probs=26.0

Q ss_pred             hHHHHHHHhh-hcCCCeeeeeeeecccC-cceeccchHHHHH
Q 047650            2 LDELLKIVEC-KNRKNQNFPTFNDVEPT-IVRKQTTTFGEAF   41 (75)
Q Consensus         2 LdEL~~I~e~-~~~~~~ViPVFY~V~ps-~Vr~q~g~f~~~f   41 (75)
                      |..|.++.+. ...+..|-+||--+||. |--..-..|.+.|
T Consensus        72 l~~l~~~~~~l~~~~~~v~~v~ISvDP~~DTp~~L~~Y~~~~  113 (174)
T PF02630_consen   72 LANLSQLQKQLGEEGKDVQFVFISVDPERDTPEVLKKYAKKF  113 (174)
T ss_dssp             HHHHHHHHHHHHHTTTTEEEEEEESSTTTC-HHHHHHHHHCH
T ss_pred             HHHHHHHHHHhhhccCceEEEEEEeCCCCCCHHHHHHHHHhc
Confidence            4566777776 55577899999999996 4333334455554


No 60 
>PF08921 DUF1904:  Domain of unknown function (DUF1904);  InterPro: IPR015017 This entry represents a family of hypothetical bacterial proteins. ; PDB: 1U9D_B.
Probab=26.81  E-value=45  Score=20.47  Aligned_cols=19  Identities=26%  Similarity=0.510  Sum_probs=11.7

Q ss_pred             hHHHHHHHhh-hcC-CCeeee
Q 047650            2 LDELLKIVEC-KNR-KNQNFP   20 (75)
Q Consensus         2 LdEL~~I~e~-~~~-~~~ViP   20 (75)
                      +|||+.|++| ++. ....+|
T Consensus        22 ideLa~i~~~p~e~ftlE~i~   42 (108)
T PF08921_consen   22 IDELAEICGCPRENFTLEWIN   42 (108)
T ss_dssp             HHHHHHHHT--GGG-EEEE--
T ss_pred             HHHHHHHHCCCcceEEEEEec
Confidence            5899999999 443 455555


No 61 
>COG2719 SpoVR Uncharacterized conserved protein [Function unknown]
Probab=26.18  E-value=76  Score=24.61  Aligned_cols=43  Identities=21%  Similarity=0.349  Sum_probs=33.8

Q ss_pred             HHHHhh-hcCCCeeeeeeeecccCc------------ceeccchHHHHHHHhHHhh
Q 047650            6 LKIVEC-KNRKNQNFPTFNDVEPTI------------VRKQTTTFGEAFAKHEEFF   48 (75)
Q Consensus         6 ~~I~e~-~~~~~~ViPVFY~V~ps~------------Vr~q~g~f~~~f~~~~~~~   48 (75)
                      .+|-+. +..++-..|+=|.|=||+            .|..-.+||+.|.+.+..+
T Consensus        20 ~eI~~ia~~~gLD~Yp~q~Evi~~eqM~da~ss~GMP~rY~HWSfGKkf~k~k~~Y   75 (495)
T COG2719          20 EEIERIAKEYGLDTYPVQYEVITSEQMMDAYSSVGMPTRYPHWSFGKKFEKTKQLY   75 (495)
T ss_pred             HHHHHHHHHhCCCCCCceEEEecHHHHHHHHHhcCCCcCCcchhHHHHHHHHHHHH
Confidence            455556 677899999999999998            3455579999999887655


No 62 
>PF07521 RMMBL:  RNA-metabolising metallo-beta-lactamase;  InterPro: IPR011108 The metallo-beta-lactamase fold contains five sequence motifs. The first four motifs are found in IPR001279 from INTERPRO and are common to all metallo-beta-lactamases. The fifth motif appears to be specific to function. This entry represents the fifth motif from metallo-beta-lactamases involved in RNA metabolism [].; PDB: 3ZQ4_D 2I7T_A 2I7V_A 2YCB_B 3BK1_A 3T3N_A 3BK2_A 3T3O_A 3AF5_A 3AF6_A ....
Probab=26.12  E-value=77  Score=15.88  Aligned_cols=17  Identities=24%  Similarity=0.374  Sum_probs=12.1

Q ss_pred             HHHHHHHhh-hcCCCeeeee
Q 047650            3 DELLKIVEC-KNRKNQNFPT   21 (75)
Q Consensus         3 dEL~~I~e~-~~~~~~ViPV   21 (75)
                      ++|.++++. +.  ..++||
T Consensus        21 ~~L~~~i~~~~p--~~vilV   38 (43)
T PF07521_consen   21 EELLEFIEQLNP--RKVILV   38 (43)
T ss_dssp             HHHHHHHHHHCS--SEEEEE
T ss_pred             HHHHHHHHhcCC--CEEEEe
Confidence            578888886 44  677776


No 63 
>smart00692 DM3 Zinc finger domain in CG10631, C. elegans LIN-15B and human P52rIPK.
Probab=26.06  E-value=61  Score=17.11  Aligned_cols=16  Identities=19%  Similarity=0.665  Sum_probs=12.4

Q ss_pred             hccCHHHHHHHHHHHH
Q 047650           48 FKDNIKKVQNWRQALK   63 (75)
Q Consensus        48 ~~~~~e~v~~W~~AL~   63 (75)
                      |..+.+..++|..|+.
T Consensus         4 FP~d~~~~~~W~~~~~   19 (59)
T smart00692        4 FPKDPELLKKWEHNLR   19 (59)
T ss_pred             CccCHHHHHHHHHHhC
Confidence            3456788999999984


No 64 
>COG1956 GAF domain-containing protein [Signal transduction mechanisms]
Probab=26.01  E-value=41  Score=22.41  Aligned_cols=15  Identities=20%  Similarity=0.339  Sum_probs=11.7

Q ss_pred             hcCCCeeeeeeeecc
Q 047650           12 KNRKNQNFPTFNDVE   26 (75)
Q Consensus        12 ~~~~~~ViPVFY~V~   26 (75)
                      ..++-+|+|||++=+
T Consensus       112 as~SEIVvPi~~~g~  126 (163)
T COG1956         112 ASNSEIVVPIFKDGK  126 (163)
T ss_pred             ccCceEEEEEEECCE
Confidence            566789999998733


No 65 
>KOG2540 consensus Cytochrome oxidase assembly factor COX11 [Posttranslational modification, protein turnover, chaperones]
Probab=25.97  E-value=33  Score=24.30  Aligned_cols=18  Identities=17%  Similarity=0.512  Sum_probs=14.5

Q ss_pred             CCeeeeeeeecccCccee
Q 047650           15 KNQNFPTFNDVEPTIVRK   32 (75)
Q Consensus        15 ~~~ViPVFY~V~ps~Vr~   32 (75)
                      -++=+|||+-+||.-...
T Consensus       213 E~vDmPVFFyIDPefa~D  230 (269)
T KOG2540|consen  213 EQVDMPVFFYIDPEFATD  230 (269)
T ss_pred             cccCcceEEEeCcccccC
Confidence            467899999999986643


No 66 
>PRK09857 putative transposase; Provisional
Probab=25.64  E-value=61  Score=23.02  Aligned_cols=25  Identities=12%  Similarity=0.090  Sum_probs=14.3

Q ss_pred             HHHHhh-hcCC---C-eeee-eeeec--ccCcc
Q 047650            6 LKIVEC-KNRK---N-QNFP-TFNDV--EPTIV   30 (75)
Q Consensus         6 ~~I~e~-~~~~---~-~ViP-VFY~V--~ps~V   30 (75)
                      +.|++. .+.|   + .|+| |||+=  .|..+
T Consensus       100 ~~iw~~~l~~~~~~LP~ViPiV~YhG~~~~w~~  132 (292)
T PRK09857        100 IAAMQNHLDAGYKTLPMVVPLLFYHGIESPYPY  132 (292)
T ss_pred             HHHHHHHHHcCCCCCCceEEEEEEcCCCCCCCC
Confidence            455565 2222   3 4899 78973  35665


No 67 
>PRK02925 glucuronate isomerase; Reviewed
Probab=25.21  E-value=1.4e+02  Score=23.14  Aligned_cols=65  Identities=15%  Similarity=0.201  Sum_probs=38.6

Q ss_pred             HHHHHHhh-hcCCCeeeeeeeecccCcceeccchHHHHHHHh----------HHhhccCHHHHHHHHHHHHHhhccc
Q 047650            4 ELLKIVEC-KNRKNQNFPTFNDVEPTIVRKQTTTFGEAFAKH----------EEFFKDNIKKVQNWRQALKVVANIS   69 (75)
Q Consensus         4 EL~~I~e~-~~~~~~ViPVFY~V~ps~Vr~q~g~f~~~f~~~----------~~~~~~~~e~v~~W~~AL~~va~~~   69 (75)
                      .|...++. ..++..---|.|.++|++=. ...+..-.|..-          .--|.+..+-+.+-.+||++++-++
T Consensus       327 ~L~~lL~~l~~~~~LpktIly~Lnp~~n~-~lat~~g~F~~~~~~gkvq~Ga~WWFnD~~~GM~~ql~~la~~glls  402 (466)
T PRK02925        327 ALSPLLDALGNENDLPKTILYTLNPTDNE-ELATMAGNFQGLGIPGKMQFGAGWWFNDQKDGMERQMEQLAETGLLS  402 (466)
T ss_pred             HHHHHHHhcccCCCCCeEEEEecCcccHH-HHHHHHcccCCCCCCCccccccchhhccCHHHHHHHHHHHHhccchh
Confidence            45556665 55555544599999999944 222222222111          0113356788999999999887554


No 68 
>PF03641 Lysine_decarbox:  Possible lysine decarboxylase;  InterPro: IPR005269 This entry represents a cytokinin-activating enzyme working in the direct activation pathway. It is a phosphoribohydrolase that converts inactive cytokinin nucleotides to the biologically active free-base forms [, ]. The proteins in this entry belong to the LOG family of proteins.; PDB: 1YDH_B 2Q4D_A 1RCU_C 1WEH_B 3SBX_F 3BQ9_B 2PMB_D 3GH1_D 1WEK_C 3QUA_A ....
Probab=25.05  E-value=77  Score=19.60  Aligned_cols=25  Identities=20%  Similarity=0.480  Sum_probs=16.8

Q ss_pred             hHHHHHHHhh-hcCCCeeee-eeeecc
Q 047650            2 LDELLKIVEC-KNRKNQNFP-TFNDVE   26 (75)
Q Consensus         2 LdEL~~I~e~-~~~~~~ViP-VFY~V~   26 (75)
                      |+||..++.. +.+...-+| |+|+.+
T Consensus        67 l~El~~~~~~~~l~~~~~~Piil~~~~   93 (133)
T PF03641_consen   67 LDELFEALTLMQLGRHNKVPIILLNID   93 (133)
T ss_dssp             HHHHHHHHHHHHTTSSTS-EEEEEECG
T ss_pred             HHHHHHHHHHHhhccccCCCEEEeCCc
Confidence            7899888887 666666667 445554


No 69 
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain. Beta-spectrin pleckstrin homology (PH) domain. Beta spectrin binds actin and functions as a major component of the cytoskeleton underlying cellular membranes. Beta spectrin consists of multiple spectrin repeats followed by a PH domain,  which binds to Inositol-1,4,5-Trisphosphate. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions.  PH domains are often involved in targeting proteins to the plasma membrane via lipid binding. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=24.82  E-value=72  Score=18.42  Aligned_cols=15  Identities=27%  Similarity=0.583  Sum_probs=12.6

Q ss_pred             cCHHHHHHHHHHHHH
Q 047650           50 DNIKKVQNWRQALKV   64 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~   64 (75)
                      .+.+.+..|-.||..
T Consensus        89 ~s~e~~~~Wi~aL~~  103 (104)
T cd01253          89 PDEEEMSSWVRALKS  103 (104)
T ss_pred             CCHHHHHHHHHHHhc
Confidence            468899999999964


No 70 
>PF07386 DUF1499:  Protein of unknown function (DUF1499);  InterPro: IPR010865 This family consists of several hypothetical bacterial and plant proteins of around 125 residues in length. The function of this family is unknown.
Probab=24.56  E-value=46  Score=20.29  Aligned_cols=15  Identities=27%  Similarity=0.417  Sum_probs=12.1

Q ss_pred             ccCHHHHHHHHHHHH
Q 047650           49 KDNIKKVQNWRQALK   63 (75)
Q Consensus        49 ~~~~e~v~~W~~AL~   63 (75)
                      +.|..++++|+.+|+
T Consensus       104 G~Nr~Ri~~~~~~L~  118 (118)
T PF07386_consen  104 GVNRRRIEALRAALE  118 (118)
T ss_pred             chhHHHHHHHHHHhC
Confidence            346799999999984


No 71 
>PF05485 THAP:  THAP domain;  InterPro: IPR006612 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. The THAP domain is an ~90-residue domain restricted to animals, which is shared between the THAP family of cellular DNA-binding proteins, and transposases from mobile genomic parasites. The defined THAP domain includes: a C2CH signature (consensus: C-x(2,4)-C-x(35,50)-C-x(2)-H); three additional key residues that are strictly conserved in all THAP domains that have been found to date (THAP1 amino acids P26, W36, F58); a C-terminal AVPTIF box; and several other conserved amino acid positions with distinct physicochemical properties (e.g. hydrophobic and polar). The THAP domain can be found in one or more copies and can be associated with other domains, such as the C2H2-type zinc finger. The THAP domain is supposed to be a DNA-binding domain (DBD) [, ].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding; PDB: 3KDE_C 2D8R_A 2JM3_A 2KO0_A 2JTG_A 2L1G_A.
Probab=24.19  E-value=68  Score=17.75  Aligned_cols=19  Identities=11%  Similarity=0.164  Sum_probs=13.6

Q ss_pred             ccCHHHHHHHHHHHHHhhc
Q 047650           49 KDNIKKVQNWRQALKVVAN   67 (75)
Q Consensus        49 ~~~~e~v~~W~~AL~~va~   67 (75)
                      ..+.+..++|..|+.....
T Consensus        24 P~d~~~~~~W~~~~~~~~~   42 (84)
T PF05485_consen   24 PKDPERRKKWLKACGREDW   42 (84)
T ss_dssp             -SSHHHHHHHHHHHTSTCG
T ss_pred             CCCHHHHHHHHHHhccccc
Confidence            4467888999999865443


No 72 
>PF15411 PH_10:  Pleckstrin homology domain
Probab=24.07  E-value=46  Score=20.60  Aligned_cols=12  Identities=42%  Similarity=0.930  Sum_probs=10.6

Q ss_pred             CHHHHHHHHHHH
Q 047650           51 NIKKVQNWRQAL   62 (75)
Q Consensus        51 ~~e~v~~W~~AL   62 (75)
                      +++....|+.||
T Consensus       105 nee~l~~W~~~L  116 (116)
T PF15411_consen  105 NEEQLEQWRSAL  116 (116)
T ss_pred             CHHHHHHHHhhC
Confidence            688999999986


No 73 
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain. Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain. The GPBP protein is a kinase that phosphorylates an N-terminal region of the alpha 3 chain of type IV collagen , which is commonly known as the goodpasture antigen.  It has has an N-terminal PH domain and a C-terminal START domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cyt
Probab=23.88  E-value=84  Score=18.19  Aligned_cols=15  Identities=13%  Similarity=0.275  Sum_probs=12.4

Q ss_pred             cCHHHHHHHHHHHHH
Q 047650           50 DNIKKVQNWRQALKV   64 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~   64 (75)
                      ++++..++|.+||..
T Consensus        76 ~s~~e~~~Wi~al~~   90 (91)
T cd01247          76 ENSQSRLLWMDSVVR   90 (91)
T ss_pred             CCHHHHHHHHHHHhh
Confidence            467889999999964


No 74 
>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]
Probab=23.72  E-value=1.6e+02  Score=23.75  Aligned_cols=63  Identities=13%  Similarity=0.260  Sum_probs=44.6

Q ss_pred             hcCCCeeeeeeeecccCcceec-cchHHHHHHHhHHhhccCHHHHHHHHHHHHHhhcccccccc
Q 047650           12 KNRKNQNFPTFNDVEPTIVRKQ-TTTFGEAFAKHEEFFKDNIKKVQNWRQALKVVANISGWELR   74 (75)
Q Consensus        12 ~~~~~~ViPVFY~V~ps~Vr~q-~g~f~~~f~~~~~~~~~~~e~v~~W~~AL~~va~~~G~~~~   74 (75)
                      ..+|....|-|..+|++|+-.. ...|...+..+.+....-.++|...+.++...+..-|..+.
T Consensus       139 ~l~g~~~~~~~~~~D~~dlsl~kLeelr~~L~~L~~ek~~Rlekv~~~~~~I~~l~~~Lg~~~~  202 (660)
T KOG4302|consen  139 ELGGPEDLPSFLIADESDLSLEKLEELREHLNELQKEKSDRLEKVLELKEEIKSLCSVLGLDFS  202 (660)
T ss_pred             HhcCCccCCcccccCcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCcc
Confidence            5566789999999999999743 34565555555544332356788888999888888776653


No 75 
>COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=23.55  E-value=51  Score=24.98  Aligned_cols=27  Identities=19%  Similarity=0.437  Sum_probs=19.7

Q ss_pred             hHHHHHHHhh-hcCCCeeeeeeeecccCcceec
Q 047650            2 LDELLKIVEC-KNRKNQNFPTFNDVEPTIVRKQ   33 (75)
Q Consensus         2 LdEL~~I~e~-~~~~~~ViPVFY~V~ps~Vr~q   33 (75)
                      +.+|.++.+. +.-+   +|  |.+||+-||..
T Consensus       241 ~~~~~~v~~~L~~~g---~~--~~id~~lvRGL  268 (429)
T COG0124         241 LEHLEELLALLDALG---IS--YEIDPSLVRGL  268 (429)
T ss_pred             HHHHHHHHHHHHHcC---CC--EEEccceecch
Confidence            4566666666 6555   66  99999999863


No 76 
>cd03063 TRX_Fd_FDH_beta TRX-like [2Fe-2S] Ferredoxin (Fd) family, NAD-dependent formate dehydrogenase (FDH) beta subunit; composed of proteins similar to the beta subunit of NAD-linked FDH of Ralstonia eutropha, a soluble enzyme that catalyzes the irreversible oxidation of formate to carbon dioxide accompanied by the reduction of NAD to NADH. FDH is a heteromeric enzyme composed of four nonidentical subunits (alpha, beta, gamma and delta). The FDH beta subunit contains a NADH:ubiquinone oxidoreductase (Nuo) F domain C-terminal to a Fd-like domain without the active site cysteines. The absence of conserved metal-binding residues in the putative active site suggests that members of this subfamily have lost the ability to bind iron-sulfur clusters in the N-terminal Fd-like domain. The C-terminal NuoF domain is a component of Nuo, a multisubunit complex catalyzing the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane. NuoF contains one [4Fe-4S] c
Probab=23.43  E-value=28  Score=20.80  Aligned_cols=12  Identities=25%  Similarity=0.174  Sum_probs=10.0

Q ss_pred             eee-ecccCccee
Q 047650           21 TFN-DVEPTIVRK   32 (75)
Q Consensus        21 VFY-~V~ps~Vr~   32 (75)
                      ||| +|+|.||..
T Consensus        60 v~Y~~V~~edv~~   72 (92)
T cd03063          60 VAYGPVTPADVAS   72 (92)
T ss_pred             EEEEeCCHHHHHH
Confidence            999 599999864


No 77 
>PTZ00240 60S ribosomal protein P0; Provisional
Probab=23.27  E-value=83  Score=23.02  Aligned_cols=50  Identities=20%  Similarity=0.076  Sum_probs=32.7

Q ss_pred             CCeeeeeeeecccCcceeccchHHHHHHHhHHhhccCHHHHHHHHHHHHHhhccc
Q 047650           15 KNQNFPTFNDVEPTIVRKQTTTFGEAFAKHEEFFKDNIKKVQNWRQALKVVANIS   69 (75)
Q Consensus        15 ~~~ViPVFY~V~ps~Vr~q~g~f~~~f~~~~~~~~~~~e~v~~W~~AL~~va~~~   69 (75)
                      .+-|-|..|+++.-.|-...-.|.....+..     +++-..++..|+..+++++
T Consensus       184 ~L~IkP~~~gl~l~~vyd~g~i~~~~vL~i~-----~e~~~~~~~~a~~~~~~ls  233 (323)
T PTZ00240        184 KLNISPFYYQVEVLSVWDRGVLFTREDLSMT-----EDVVEKMLMEGLSNVAAMS  233 (323)
T ss_pred             HcCCCeEEEEEEEEEEEeCCeecCHHHcCCC-----HHHHHHHHHHHHHHHHHHH
Confidence            3567888899888888765445654433221     2344667888888888765


No 78 
>PF04333 VacJ:  VacJ like lipoprotein;  InterPro: IPR007428  Lipoproteins in Gram-negative microbes also act as structural stabilisers, forming non-covalent bonds with peptidoglycan on the outer membrane of the cell []. Following completion of the genomes of several Gram-negative prokaryotes, a putative lipoprotein, VacJ, has been discovered in the raw sequence open reading frames. Biochemical analysis of the Shigella flexneri VacJ protein revealed it to be essential for virulence, promoting spread of bacterial cells through the intercellular space of tissues [].   Upon expression in the facultative intracellular microbe, host cells form membranous protrusions containing the pathogen, allowing it to move to the cytoplasm of the next target cell. As homologues of this lipoprotein have largely been found in obligate or facultative intracellular microbial genomes, it appears to be specific for that particular lifestyle []. ; GO: 0016020 membrane
Probab=22.96  E-value=48  Score=22.58  Aligned_cols=27  Identities=15%  Similarity=0.272  Sum_probs=22.4

Q ss_pred             CCCeeeeeeeecccCcceeccchHHHHHHH
Q 047650           14 RKNQNFPTFNDVEPTIVRKQTTTFGEAFAK   43 (75)
Q Consensus        14 ~~~~ViPVFY~V~ps~Vr~q~g~f~~~f~~   43 (75)
                      +.-+|+|++   -||.+|.-.|..++.+..
T Consensus       118 GpYlvLP~l---GPst~RD~~G~~~d~~~~  144 (200)
T PF04333_consen  118 GPYLVLPFL---GPSTLRDAVGLVVDSFLN  144 (200)
T ss_pred             CCeEEEecC---CCCchhhccchhhhhccc
Confidence            345899995   899999999998888863


No 79 
>cd06418 GH25_BacA-like BacA is a bacterial lysin from Enterococcus faecalis that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.  BacA is homologous to the YbfG and YkuG lysins of Bacillus subtilis. BacA has a C-terminal catalytic glycosyl hydrolase family 25 (GH25) domain and an N-terminal peptidoglycan-binding domain comprised of three alpha helices which is similar to a domain found in matrixins.
Probab=22.87  E-value=1.5e+02  Score=20.10  Aligned_cols=22  Identities=23%  Similarity=0.270  Sum_probs=13.8

Q ss_pred             HHHHHHhhhcCCCeeeeeeeecccC
Q 047650            4 ELLKIVECKNRKNQNFPTFNDVEPT   28 (75)
Q Consensus         4 EL~~I~e~~~~~~~ViPVFY~V~ps   28 (75)
                      |+..|..   .|+.++|||-.-.++
T Consensus        57 e~~~i~~---~Gl~~~pIyq~~~~~   78 (212)
T cd06418          57 ELETITA---AGLKVFPIYQGGGYS   78 (212)
T ss_pred             HHHHHHH---CCCEEEEEEECCCcc
Confidence            4444444   588888888655443


No 80 
>PF15413 PH_11:  Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C.
Probab=22.64  E-value=98  Score=18.59  Aligned_cols=16  Identities=19%  Similarity=0.430  Sum_probs=12.8

Q ss_pred             cCHHHHHHHHHHHHHh
Q 047650           50 DNIKKVQNWRQALKVV   65 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~v   65 (75)
                      ++.+....|-.||.++
T Consensus        97 ~t~~d~~~Wi~aL~~~  112 (112)
T PF15413_consen   97 ETREDRYDWIEALQEA  112 (112)
T ss_dssp             SSHHHHHHHHHHHHH-
T ss_pred             CCHHHHHHHHHHHHhC
Confidence            4678899999999864


No 81 
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain. Unc-112 pleckstrin homology (PH) domain.  Unc-112 and related proteins contain two FERM domains with a PH domain between them. Both the PH and FERM domains have a PH-like fold.  The FERM domains are likely responsible for the role of Unc-112 in organizing beta-integrin. The specific role of the Unc-112 PH domain is not known, but it is predicted to be involved in mediating membrane interactions. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=22.62  E-value=98  Score=19.11  Aligned_cols=17  Identities=29%  Similarity=0.567  Sum_probs=14.0

Q ss_pred             cCHHHHHHHHHHHHHhh
Q 047650           50 DNIKKVQNWRQALKVVA   66 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~va   66 (75)
                      ++++.-.+|.+|+.-++
T Consensus        87 dsEeqya~Wmaa~rlas  103 (106)
T cd01237          87 DNEKQYAKWMAACRLAS  103 (106)
T ss_pred             CCHHHHHHHHHHHHHhh
Confidence            46788999999998765


No 82 
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain. Outspread Pleckstrin homology (PH) domain. Outspread contains two PH domains and a C-terminal coiled-coil region. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPAses, adaptors, a well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=22.42  E-value=91  Score=18.85  Aligned_cols=15  Identities=20%  Similarity=0.472  Sum_probs=12.9

Q ss_pred             cCHHHHHHHHHHHHH
Q 047650           50 DNIKKVQNWRQALKV   64 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~   64 (75)
                      ++++..+.|.+||+.
T Consensus        88 ete~E~~~Wi~~l~~  102 (104)
T cd01236          88 ETKEEISWWLNMLMV  102 (104)
T ss_pred             CCHHHHHHHHHHHHh
Confidence            578899999999974


No 83 
>TIGR00702 uncharacterized domain. This uncharacterized domain comprises the whole of a protein in Methanococcus jannaschii and Methanobacterium thermoautotrophicum, all but the N-terminal 60 residues from a protein of Mycobacterium tuberculosis, and all but the C-terminal 180 residues from a protein in Haemophilus influenzae and Escherichia coli, among proteins from published complete genomes.
Probab=21.90  E-value=30  Score=25.38  Aligned_cols=15  Identities=20%  Similarity=0.202  Sum_probs=12.5

Q ss_pred             eeeeeeeecccCcce
Q 047650           17 QNFPTFNDVEPTIVR   31 (75)
Q Consensus        17 ~ViPVFY~V~ps~Vr   31 (75)
                      +=||||+-|.|.+..
T Consensus        31 lgipv~~av~~~~~~   45 (377)
T TIGR00702        31 LGIPVVWAVRPRDKD   45 (377)
T ss_pred             CCCCeEEEECCcccc
Confidence            358999999998875


No 84 
>PF01041 DegT_DnrJ_EryC1:  DegT/DnrJ/EryC1/StrS aminotransferase family;  InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions. The family includes StsA P72454 from SWISSPROT, StsC P77952 from SWISSPROT and StsS []. The aminotransferase activity was demonstrated for purified StsC protein as the L-glutamine:scyllo-inosose aminotransferase 2.6.1.50 from EC, which catalyses the first amino transfer in the biosynthesis of the streptidine subunit of streptomycin [].; PDB: 2FNI_A 2FNU_A 2FN6_A 2PO3_A 3UWC_A 1O61_B 1O62_B 1O69_B 1B9I_A 1B9H_A ....
Probab=21.70  E-value=47  Score=23.64  Aligned_cols=16  Identities=25%  Similarity=0.553  Sum_probs=10.4

Q ss_pred             eeeeeeecccCcceec
Q 047650           18 NFPTFNDVEPTIVRKQ   33 (75)
Q Consensus        18 ViPVFY~V~ps~Vr~q   33 (75)
                      ..|||++|+|....--
T Consensus        87 ~~pv~~Di~~~~~~id  102 (363)
T PF01041_consen   87 AEPVFVDIDPETLNID  102 (363)
T ss_dssp             -EEEEE-BETTTSSB-
T ss_pred             cEEEEEeccCCcCCcC
Confidence            4699999998876543


No 85 
>PF12515 CaATP_NAI:  Ca2+-ATPase N terminal autoinhibitory domain;  InterPro: IPR024750 This entry represents the N-terminal autoinhibitory calmodulin-binding domain characteristic of certain calcium-transporting ATPases []. This domain binds calmodulin in a calcium-dependent fashion and has a conserved RRFR sequence motif. There are two completely conserved residues (F and W) that may be functionally important.; GO: 0005516 calmodulin binding
Probab=21.65  E-value=1.1e+02  Score=16.20  Aligned_cols=15  Identities=33%  Similarity=0.722  Sum_probs=11.8

Q ss_pred             CHHHHHHHHHHHHHh
Q 047650           51 NIKKVQNWRQALKVV   65 (75)
Q Consensus        51 ~~e~v~~W~~AL~~v   65 (75)
                      ..|..++||.|..-|
T Consensus        14 s~e~l~rWR~a~~lv   28 (47)
T PF12515_consen   14 SEEALRRWRQAVGLV   28 (47)
T ss_pred             CHHHHHHHHHHhHHh
Confidence            468899999997544


No 86 
>KOG2941 consensus Beta-1,4-mannosyltransferase [Posttranslational modification, protein turnover, chaperones]
Probab=21.51  E-value=44  Score=25.39  Aligned_cols=8  Identities=75%  Similarity=1.273  Sum_probs=6.7

Q ss_pred             ChHHHHHH
Q 047650            1 CLDELLKI    8 (75)
Q Consensus         1 CLdEL~~I    8 (75)
                      ||||||+=
T Consensus       375 cl~ELVkh  382 (444)
T KOG2941|consen  375 CLDELVKH  382 (444)
T ss_pred             hHHHHHhc
Confidence            89999963


No 87 
>PF09365 DUF2461:  Conserved hypothetical protein (DUF2461);  InterPro: IPR012808 Members of this family are widely (though sparsely) distributed bacterial proteins, about 230 residues in length and in fungal proteins, which are around 400 residues in length. All members have a motif RxxRDxRFxxx[DN]KxxY. The function of this protein family is unknown.
Probab=21.10  E-value=1.4e+02  Score=20.17  Aligned_cols=48  Identities=10%  Similarity=0.136  Sum_probs=29.7

Q ss_pred             eeeeeee-ecccCcceeccchHH---HHHHHhHHhhccCHHHHHHHHHHHHHhhc
Q 047650           17 QNFPTFN-DVEPTIVRKQTTTFG---EAFAKHEEFFKDNIKKVQNWRQALKVVAN   67 (75)
Q Consensus        17 ~ViPVFY-~V~ps~Vr~q~g~f~---~~f~~~~~~~~~~~e~v~~W~~AL~~va~   67 (75)
                      .--|-|| +++|....--.|.|.   +.+....+...   +.-..|+.+|...+.
T Consensus        93 ~~~~gyY~hi~P~~~~~g~G~~~p~~~~L~~iR~~I~---~~~~~~~~il~~~~~  144 (212)
T PF09365_consen   93 SQGPGYYFHISPDGSFLGGGFYMPEKEQLKRIRQEID---DNPEEFRKILEAPEF  144 (212)
T ss_pred             CCCCEEEEEEecCccEEEEEEeeCCHHHHHHHHHHHH---hChHHHHHHHhChhh
Confidence            3456676 899999988888775   44444433332   333447777766554


No 88 
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain. Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain. CDEP consists of a Ferm domain, a rhoGEF (DH) domain followed by two PH domains.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=20.88  E-value=1.2e+02  Score=18.05  Aligned_cols=18  Identities=11%  Similarity=0.244  Sum_probs=14.8

Q ss_pred             cCHHHHHHHHHHHHHhhc
Q 047650           50 DNIKKVQNWRQALKVVAN   67 (75)
Q Consensus        50 ~~~e~v~~W~~AL~~va~   67 (75)
                      .++++..+|..||+++.+
T Consensus        81 ~s~~Ek~~Wi~~i~~aI~   98 (99)
T cd01220          81 STRAEKEKWLADLSKAIA   98 (99)
T ss_pred             CCHHHHHHHHHHHHHHhh
Confidence            467889999999988753


No 89 
>PF12612 TFCD_C:  Tubulin folding cofactor D C terminal;  InterPro: IPR022577  This region is found in eukaryotes, and is typically between 182 and 199 amino acids in length. There is a single completely conserved residue R that may be functionally important. Tubulin folding cofactor D does not co-polymerise with microtubules either in vivo or in vitro, but instead modulates microtubule dynamics by sequestering beta-tubulin from GTP-bound alphabeta-heterodimers in microtubules []. 
Probab=20.77  E-value=63  Score=21.19  Aligned_cols=21  Identities=24%  Similarity=0.371  Sum_probs=16.4

Q ss_pred             hHHHHHHHhh-hcCCCeeeeee
Q 047650            2 LDELLKIVEC-KNRKNQNFPTF   22 (75)
Q Consensus         2 LdEL~~I~e~-~~~~~~ViPVF   22 (75)
                      ++.|..|.+. ....++++|.+
T Consensus       129 ~~~l~~il~~~~~~dRv~vP~l  150 (193)
T PF12612_consen  129 LSDLLSILKENLRNDRVVVPLL  150 (193)
T ss_pred             HHHHHHHHHHhCCCCCeeecHH
Confidence            3567777777 77789999987


No 90 
>PF07964 Red1:  Rec10 / Red1;  InterPro: IPR012491 Rec10 / Red1 is involved in meiotic recombination and chromosome segregation during homologous chromosome formation. This protein localises to the synaptonemal complex in Saccharomyces cerevisiae and the analogous structures (linear elements) in Schizosaccharomyces pombe []. This family is currently only found in fungi. ; GO: 0007059 chromosome segregation, 0007131 reciprocal meiotic recombination
Probab=20.77  E-value=1.2e+02  Score=24.72  Aligned_cols=41  Identities=10%  Similarity=0.331  Sum_probs=34.9

Q ss_pred             ceeccchHHHHHHHhHHhhccCHHHHHHHHHHHHHhhcccc
Q 047650           30 VRKQTTTFGEAFAKHEEFFKDNIKKVQNWRQALKVVANISG   70 (75)
Q Consensus        30 Vr~q~g~f~~~f~~~~~~~~~~~e~v~~W~~AL~~va~~~G   70 (75)
                      ++..+..|..-|.++...|..|-+++-++..-++...+|+-
T Consensus       654 ~kELSeKYQ~LF~eLQ~sFqnDteeM~~FvgEiKdml~LPE  694 (706)
T PF07964_consen  654 MKELSEKYQRLFKELQKSFQNDTEEMLKFVGEIKDMLNLPE  694 (706)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHhcCCH
Confidence            44567889999999999999999999999888888888763


No 91 
>COG1236 YSH1 Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis]
Probab=20.58  E-value=80  Score=23.61  Aligned_cols=20  Identities=15%  Similarity=0.278  Sum_probs=14.5

Q ss_pred             HHHHHhh--hcCCCeeeeeeee
Q 047650            5 LLKIVEC--KNRKNQNFPTFND   24 (75)
Q Consensus         5 L~~I~e~--~~~~~~ViPVFY~   24 (75)
                      |+.+++.  ..+|.++||+|+-
T Consensus       205 f~~~v~~~l~~GG~vlipafa~  226 (427)
T COG1236         205 FIESVKAALERGGTVLIPAFAL  226 (427)
T ss_pred             HHHHHHHHHhCCCEEEEecccc
Confidence            4555665  6778899999964


No 92 
>PHA03269 envelope glycoprotein C; Provisional
Probab=20.53  E-value=19  Score=28.19  Aligned_cols=50  Identities=24%  Similarity=0.517  Sum_probs=33.7

Q ss_pred             hhcCCCeeeeeeee-cccCcceeccchHHHHHHHhH--Hhhcc-----CHHHHHHHHHH
Q 047650           11 CKNRKNQNFPTFND-VEPTIVRKQTTTFGEAFAKHE--EFFKD-----NIKKVQNWRQA   61 (75)
Q Consensus        11 ~~~~~~~ViPVFY~-V~ps~Vr~q~g~f~~~f~~~~--~~~~~-----~~e~v~~W~~A   61 (75)
                      |--.|...||-|.+ +-|.-++-.+| +|.+|..|+  +.+++     +...+.+||--
T Consensus       162 ~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  219 (566)
T PHA03269        162 CTHGGIQFIPYFHKFILPCYLQIFTG-QGAAFKQHELPKTYEEDFLDPEGANITRWKPL  219 (566)
T ss_pred             EEecceeecchhheecceeEEEEeec-chhhheeccccchhhhhccCcccccccccccc
Confidence            34457889999987 56888887776 788888776  43331     12346778754


No 93 
>PF05678 VQ:  VQ motif;  InterPro: IPR008889 This short motif is found in a variety of plant proteins. These proteins vary greatly in length and are mostly composed of low complexity regions. They all conserve a short motif FXhVQChTG, where X is any amino acid and h is a hydrophobic amino acid. The function of this motif is uncertain, however one protein in this family has been found to bind the SigA sigma factor Q9LDH1 from SWISSPROT. It would seem plausible that this motif is needed for this activity and that this whole family might be involved in modulating plastid sigma factors.
Probab=20.47  E-value=32  Score=16.64  Aligned_cols=13  Identities=31%  Similarity=0.457  Sum_probs=9.3

Q ss_pred             eeeeeecccCcce
Q 047650           19 FPTFNDVEPTIVR   31 (75)
Q Consensus        19 iPVFY~V~ps~Vr   31 (75)
                      =|-+|++||++.|
T Consensus         4 ~p~vi~~d~~~Fr   16 (31)
T PF05678_consen    4 PPTVIHTDPSNFR   16 (31)
T ss_pred             CCEEEEeCHHHHH
Confidence            4677888887765


No 94 
>PF11004 Kdo_hydroxy:  3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase;  InterPro: IPR021266  This bacterial family of proteins has no known function. 
Probab=20.35  E-value=70  Score=23.12  Aligned_cols=36  Identities=17%  Similarity=0.281  Sum_probs=25.1

Q ss_pred             cCCCeeeeeeeecccCcceeccchHHHHHHHhHHhhc
Q 047650           13 NRKNQNFPTFNDVEPTIVRKQTTTFGEAFAKHEEFFK   49 (75)
Q Consensus        13 ~~~~~ViPVFY~V~ps~Vr~q~g~f~~~f~~~~~~~~   49 (75)
                      +.|..|+-||-+|+|...-. ...-|+.|.+...+|-
T Consensus       137 ~~G~RiLRvF~NINP~g~pR-vWrvGEpF~~~a~rfl  172 (281)
T PF11004_consen  137 TYGERILRVFTNINPDGEPR-VWRVGEPFEDMARRFL  172 (281)
T ss_pred             CCCceeeEEeeccCCCCCCc-ccccCCChHHHHHHhc
Confidence            45789999999999994322 2344677777776663


No 95 
>TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein. This family of proteins is universal in the archaea and consistsof an N-terminal type-1 KH-domain (pfam00013) a central beta-lactamase-domain (pfam00753) with a C-terminal motif associated with RNA metabolism (pfam07521). KH-domains are associated with RNA-binding, so taken together, this protein is a likely metal-dependent RNAase. This family was defined in as arCOG01782.
Probab=20.34  E-value=83  Score=24.91  Aligned_cols=20  Identities=35%  Similarity=0.572  Sum_probs=12.1

Q ss_pred             HHHHHHHh-h-hcCCCeeeeee
Q 047650            3 DELLKIVE-C-KNRKNQNFPTF   22 (75)
Q Consensus         3 dEL~~I~e-~-~~~~~~ViPVF   22 (75)
                      ++|..++. + +.+|.++||+|
T Consensus       389 ~~l~~~I~~tl~~gG~VLIP~f  410 (630)
T TIGR03675       389 KELIKVVNETIKRGGKVLIPVF  410 (630)
T ss_pred             HHHHHHHHHHHhCCCEEEEEec
Confidence            34444433 3 66777888876


No 96 
>PF12646 DUF3783:  Domain of unknown function (DUF3783);  InterPro: IPR016621 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=20.14  E-value=1.3e+02  Score=16.09  Aligned_cols=28  Identities=21%  Similarity=0.320  Sum_probs=23.1

Q ss_pred             HHHHHHHhh-hcCCCeeeeeeeecccCcce
Q 047650            3 DELLKIVEC-KNRKNQNFPTFNDVEPTIVR   31 (75)
Q Consensus         3 dEL~~I~e~-~~~~~~ViPVFY~V~ps~Vr   31 (75)
                      .||.++++. ++.|. -+|+|=-+.|....
T Consensus        12 ~el~~~l~~~r~~~~-~~~~kAvlT~tN~~   40 (58)
T PF12646_consen   12 EELDKFLDALRKAGI-PIPLKAVLTPTNIN   40 (58)
T ss_pred             HHHHHHHHHHHHcCC-CcceEEEECCCccc
Confidence            478888888 77777 88999889998874


Done!